We read every piece of feedback, and take your input very seriously.
To see all available qualifiers, see our documentation.
Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.
By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.
Already on GitHub? Sign in to your account
Getting an error on the following step, any help would be appreciated!
[66/af4c33] process > GAP:PROCESS_SINGLETON_GENOMES:PROKKA (MGYG000000010) [ 42%] 3 of 7, failed: 1
Error:
ERROR ~ Error executing process > 'GAP:PROCESS_SINGLETON_GENOMES:PROKKA (MGYG000000030)' Caused by: Process `GAP:PROCESS_SINGLETON_GENOMES:PROKKA (MGYG000000030)` terminated with an error exit status (2) Command executed: cat MGYG000000030.fa | tr '-' ' ' > MGYG000000030_cleaned.fasta export JAVA_TOOL_OPTIONS="-XX:-UsePerfData" prokka MGYG000000030_cleaned.fasta --cpus 8 --kingdom 'Bacteria' --outdir MGYG000000030_prokka --prefix MGYG000000030 --force --locustag MGYG000000030 Command exit status: 2 Command output: (empty) Command error: [18:57:17] Modify product: Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA => putative FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [18:57:17] Modify product: Putative zinc metalloprotease aq_1964 => Putative zinc metalloprotease [18:57:17] Modify product: Uncharacterized ABC transporter ATP-binding protein TM_0288 => putative ABC transporter ATP-binding protein [18:57:17] Modify product: Uncharacterized ABC transporter ATP-binding protein Rv1273c => putative ABC transporter ATP-binding protein [18:57:17] Modify product: Probable ATP-dependent transporter SufC => putative ATP-dependent transporter SufC [18:57:17] Modify product: Probable dual-specificity RNA methyltransferase RlmN => putative dual-specificity RNA methyltransferase RlmN [18:57:17] Modify product: Probable butyrate:acetyl-CoA coenzyme A-transferase => putative butyrate:acetyl-CoA coenzyme A-transferase [18:57:17] Modify product: Probable FMN/FAD exporter YeeO => putative FMN/FAD exporter YeeO [18:57:17] Modify product: Putative multidrug export ATP-binding/permease protein SAV1866 => Putative multidrug export ATP-binding/permease protein [18:57:17] Modify product: Probable transcriptional regulatory protein HP_0162 => putative transcriptional regulatory protein [18:57:17] Modify product: Probable bifunctional oligoribonuclease and PAP phosphatase NrnA => putative bifunctional oligoribonuclease and PAP phosphatase NrnA [18:57:17] Modify product: UPF0758 protein YsxA => hypothetical protein [18:57:17] Modify product: 23S rRNA 5-hydroxycytidine C2501 synthase => 23S rRNA 5-hydroxycytidine synthase [18:57:17] Modify product: UPF0194 membrane protein YbhG => hypothetical protein [18:57:17] Modify product: Uncharacterized zinc protease Rv2782c => putative zinc protease [18:57:17] Modify product: Probable sulfoacetate transporter SauU => putative sulfoacetate transporter SauU [18:57:17] Modify product: Probable cysteine desulfurase => putative cysteine desulfurase [18:57:17] Modify product: Probable branched-chain-amino-acid aminotransferase => putative branched-chain-amino-acid aminotransferase [18:57:17] Modify product: Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI => putative multidrug resistance ABC transporter ATP-binding/permease protein YheI [18:57:17] Modify product: UPF0353 protein Rv1481 => hypothetical protein [18:57:17] Modify product: UPF0353 protein Rv1481 => hypothetical protein [18:57:18] Modify product: Probable copper-transporting ATPase PacS => putative copper-transporting ATPase PacS [18:57:18] Modify product: Uncharacterized sugar kinase YdjH => putative sugar kinase YdjH [18:57:18] Modify product: UPF0371 protein DIP2346 => hypothetical protein [18:57:18] Modify product: UPF0053 protein HI_0107 => hypothetical protein [18:57:18] Modify product: Putative glutamine amidotransferase Rv2859c => Putative glutamine amidotransferase [18:57:18] Modify product: Tricorn protease homolog 1 => Tricorn protease [18:57:18] Modify product: Probable L-galactonate transporter => putative L-galactonate transporter [18:57:18] Modify product: UPF0701 protein HI_0467 => hypothetical protein [18:57:18] Modify product: Uncharacterized protein YhaP => putative protein YhaP [18:57:18] Modify product: Uncharacterized protein YqeN => putative protein YqeN [18:57:18] Modify product: GTP cyclohydrolase 1 type 2 homolog => GTP cyclohydrolase 1 type 2 [18:57:18] Modify product: Uncharacterized ABC transporter ATP-binding protein YheS => putative ABC transporter ATP-binding protein YheS [18:57:18] Modify product: Bifunctional protein FolD => Bifunctional protein FolD protein [18:57:18] Modify product: Uncharacterized epimerase/dehydratase SA0511 => putative epimerase/dehydratase [18:57:18] Modify product: Putative 2-hydroxyacid dehydrogenase HI_1556 => Putative 2-hydroxyacid dehydrogenase [18:57:18] Modify product: Probable glycine dehydrogenase (decarboxylating) subunit 2 => putative glycine dehydrogenase (decarboxylating) subunit 2 [18:57:18] Modify product: Probable chromate transport protein => putative chromate transport protein [18:57:18] Modify product: Probable manganese efflux pump MntP => putative manganese efflux pump MntP [18:57:18] Modify product: Probable GTP-binding protein EngB => putative GTP-binding protein EngB [18:57:18] Modify product: RutC family protein HI_0719 => RutC family protein [18:57:18] Modify product: Probable glycine dehydrogenase (decarboxylating) subunit 1 => putative glycine dehydrogenase (decarboxylating) subunit 1 [18:57:18] Modify product: Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog => Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit [18:57:18] Cleaned 45 /product names [18:57:18] Deleting unwanted file: MGYG000000030_prokka/MGYG000000030.sprot.tmp.115.faa [18:57:18] Deleting unwanted file: MGYG000000030_prokka/MGYG000000030.sprot.tmp.115.blast [18:57:18] There are still 1050 unannotated CDS left (started with 1689) [18:57:18] Will use hmmer3 to search against /usr/local/db/hmm/HAMAP.hmm with 8 CPUs [18:57:18] Running: cat MGYG000000030_prokka\/MGYG000000030\.HAMAP\.hmm\.tmp\.115\.faa | parallel --gnu --plain -j 8 --block 23723 --recstart '>' --pipe hmmscan --noali --notextw --acc -E 1e-09 --cpu 1 /usr/local/db/hmm/HAMAP.hmm /dev/stdin > MGYG000000030_prokka\/MGYG000000030\.HAMAP\.hmm\.tmp\.115\.hmmer3 2> /dev/null [18:57:23] Could not run command: cat MGYG000000030_prokka\/MGYG000000030\.HAMAP\.hmm\.tmp\.115\.faa | parallel --gnu --plain -j 8 --block 23723 --recstart '>' --pipe hmmscan --noali --notextw --acc -E 1e-09 --cpu 1 /usr/local/db/hmm/HAMAP.hmm /dev/stdin > MGYG000000030_prokka\/MGYG000000030\.HAMAP\.hmm\.tmp\.115\.hmmer3 2> /dev/null
The file MGYG000000000.HAMAP.hmm.tmp.115.faa seems to be fine:
>1 MERSGFSTRLGFILVSAGCAIGLGNVWRFPYITGQYGGASFVLIYLLFLAILGLPIMVAEFAVGRASIRSAAMSFDVLEPKGTKWHWHKYTAIGGNMILMMFYTTVAGWMLYYLYKTATGAFDGLDAAGIGAVFGDLLQDPVTMGGYMAAIVLLCGGVCYLGVEAGVERITKWMMTCLLLLMVILGINSVLLPGAGEGLKYYLYPDFGRLMEHGLKEVIFAAMGQAFFTLSIGMGSLAVFGSYIGKSKRLTGEAVWIIILDTFVAIMAGLIIFPACFSYGVSPSSGPNLLFVTLPNVFNAMPLGRLWGTLFFLFMTFAAMSTVIAVFENLVVCFFDLLRIDRHKIICAGMPIVILLSLPCVLGFNEWSWIQPLGKGSGILDLEDFLVSNNILPLGSLVYMAFCTSRYGWGWDNFIKEADTGRGMEFPKWIRFYVTYILPLIVLVIFVNGYYALFFSR >2 MAILLVITAILALIHLYHLSDKMKRLDYVYLMVLLIVMGLNTDNADYAAYERIYQKVSYATTWEEIMRAHTDKGYVFLNWLATVIGMDYKCFHLGLFTLLLGGIFIIAKRIGTPICALFLAYTMYPMFMDAIQIRNFIISAVLLFSIYCYAHANVRWYAIGVISLTIAVTIHPFILIFIPFIVFYKMYDTERFRPITYIPICLGLLSIAIKILIDTYWNEVTAMLTVLADWASRGHSYIGHQVLTSRQFKIYLVVVIFAWLLYKAKKYLSTSECVNDIQKKFVELSFVAFLYLICWMPLFALDINLATRMPRDLFLVAYMSLGIYLSKCTSQRIKIGLLFGIMFLAFFFGLVDLYISTDRFNVDVILSHNLLL >3 MHIILVGPEYYNYSEGIISAFISLGCEVDFFPSVEFYENCSWYQRRLYKLGYKSLEKIWNNDWETRFREFIANRIRKDTIFLFCTGNMISVRLLKDLDAYVKVLYMWDSVKRYSDDFQSRLKLYDYLFAFEFGDIEFVRKKYGVSMQYMPLGYDSDFYYPDDNVVKDIDISFVGSCTKMRMNLLEKVAR .....
The text was updated successfully, but these errors were encountered:
A little more insight: this works fine when running with singularity - no error, however consistently seeing failures on docker
Sorry, something went wrong.
Hi @amardeepranu
How are you running the pipeline? Locally, in an HPC cluster using a scheduler?
Cheers
prokka is showing 'prokka --setupdb' while running a sequence ,what is the solution for this
mberacochea
No branches or pull requests
Getting an error on the following step, any help would be appreciated!
Error:
The file MGYG000000000.HAMAP.hmm.tmp.115.faa seems to be fine:
The text was updated successfully, but these errors were encountered: