diff --git a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml index 4fd18bb47b..f9573f4a19 100644 --- a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml +++ b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml index 1b35a9dfee..56e7b2741a 100644 --- a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml +++ b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml b/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml index f16e27a231..ae0afd7d3b 100644 --- a/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml +++ b/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml b/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml index ec8abfef02..f7d0a35a8c 100644 --- a/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml +++ b/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigquery_v1beta1_bigquerydataset.yaml b/crds/bigquery_v1beta1_bigquerydataset.yaml index fe65f0b7de..fe99a28c9e 100644 --- a/crds/bigquery_v1beta1_bigquerydataset.yaml +++ b/crds/bigquery_v1beta1_bigquerydataset.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigquery_v1beta1_bigqueryjob.yaml b/crds/bigquery_v1beta1_bigqueryjob.yaml index 2d2bf5a0fa..5e365ed309 100644 --- a/crds/bigquery_v1beta1_bigqueryjob.yaml +++ b/crds/bigquery_v1beta1_bigqueryjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigquery_v1beta1_bigquerytable.yaml b/crds/bigquery_v1beta1_bigquerytable.yaml index af3bbd81f2..5f6c30c80c 100644 --- a/crds/bigquery_v1beta1_bigquerytable.yaml +++ b/crds/bigquery_v1beta1_bigquerytable.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtableappprofile.yaml b/crds/bigtable_v1beta1_bigtableappprofile.yaml index 3a05b3c6ed..aea4ccdc68 100644 --- a/crds/bigtable_v1beta1_bigtableappprofile.yaml +++ b/crds/bigtable_v1beta1_bigtableappprofile.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtablegcpolicy.yaml b/crds/bigtable_v1beta1_bigtablegcpolicy.yaml index bd6e7ba041..85c7fb5f2b 100644 --- a/crds/bigtable_v1beta1_bigtablegcpolicy.yaml +++ b/crds/bigtable_v1beta1_bigtablegcpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtableinstance.yaml b/crds/bigtable_v1beta1_bigtableinstance.yaml index 12f205493b..7eabc6945e 100644 --- a/crds/bigtable_v1beta1_bigtableinstance.yaml +++ b/crds/bigtable_v1beta1_bigtableinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtabletable.yaml b/crds/bigtable_v1beta1_bigtabletable.yaml index 6053348bb5..73e247c2aa 100644 --- a/crds/bigtable_v1beta1_bigtabletable.yaml +++ b/crds/bigtable_v1beta1_bigtabletable.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml b/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml index 60679faa58..dd17e50485 100644 --- a/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml +++ b/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml b/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml index 3d55fbe2b2..ed6ed37c0c 100644 --- a/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml +++ b/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml b/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml index 95f5da89f5..1d78363a7e 100644 --- a/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml +++ b/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -88,9 +88,6 @@ spec: type: array clusterAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -201,9 +198,6 @@ spec: type: string istioServiceIdentityAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -254,9 +248,6 @@ spec: type: object kubernetesNamespaceAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -306,9 +297,6 @@ spec: type: object kubernetesServiceAccountAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied diff --git a/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml b/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml index 490cfa31bc..5e1e28f8f4 100644 --- a/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml +++ b/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml index 61ca47e52c..e8e46aca4c 100644 --- a/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml +++ b/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml b/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml index 52d44da3c5..30818477f8 100644 --- a/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml +++ b/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml b/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml index ca22ad79a6..1d0b4ce39d 100644 --- a/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml +++ b/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml b/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml index 87fd62cb31..f80445a371 100644 --- a/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml +++ b/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computeaddress.yaml b/crds/compute_v1beta1_computeaddress.yaml index 1e6ae68b18..b2a15cdf64 100644 --- a/crds/compute_v1beta1_computeaddress.yaml +++ b/crds/compute_v1beta1_computeaddress.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computebackendbucket.yaml b/crds/compute_v1beta1_computebackendbucket.yaml index 69c2c29923..1cb68916c9 100644 --- a/crds/compute_v1beta1_computebackendbucket.yaml +++ b/crds/compute_v1beta1_computebackendbucket.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computebackendservice.yaml b/crds/compute_v1beta1_computebackendservice.yaml index c01c4d7396..373ed1a0df 100644 --- a/crds/compute_v1beta1_computebackendservice.yaml +++ b/crds/compute_v1beta1_computebackendservice.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computedisk.yaml b/crds/compute_v1beta1_computedisk.yaml index 08a9ad7bba..22bd0c42ed 100644 --- a/crds/compute_v1beta1_computedisk.yaml +++ b/crds/compute_v1beta1_computedisk.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeexternalvpngateway.yaml b/crds/compute_v1beta1_computeexternalvpngateway.yaml index 45ef33f086..57831dc4ae 100644 --- a/crds/compute_v1beta1_computeexternalvpngateway.yaml +++ b/crds/compute_v1beta1_computeexternalvpngateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computefirewall.yaml b/crds/compute_v1beta1_computefirewall.yaml index bb7671ef1e..a710bf570a 100644 --- a/crds/compute_v1beta1_computefirewall.yaml +++ b/crds/compute_v1beta1_computefirewall.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computefirewallpolicy.yaml b/crds/compute_v1beta1_computefirewallpolicy.yaml index 469c864a91..edae631eea 100644 --- a/crds/compute_v1beta1_computefirewallpolicy.yaml +++ b/crds/compute_v1beta1_computefirewallpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computefirewallpolicyassociation.yaml b/crds/compute_v1beta1_computefirewallpolicyassociation.yaml index bfb6439f88..2647e66821 100644 --- a/crds/compute_v1beta1_computefirewallpolicyassociation.yaml +++ b/crds/compute_v1beta1_computefirewallpolicyassociation.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computefirewallpolicyrule.yaml b/crds/compute_v1beta1_computefirewallpolicyrule.yaml index ce730069bc..959aff4d41 100644 --- a/crds/compute_v1beta1_computefirewallpolicyrule.yaml +++ b/crds/compute_v1beta1_computefirewallpolicyrule.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computeforwardingrule.yaml b/crds/compute_v1beta1_computeforwardingrule.yaml index fb765eb517..97ae746b88 100644 --- a/crds/compute_v1beta1_computeforwardingrule.yaml +++ b/crds/compute_v1beta1_computeforwardingrule.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computehealthcheck.yaml b/crds/compute_v1beta1_computehealthcheck.yaml index 11d839aa21..ea933764fd 100644 --- a/crds/compute_v1beta1_computehealthcheck.yaml +++ b/crds/compute_v1beta1_computehealthcheck.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computehttphealthcheck.yaml b/crds/compute_v1beta1_computehttphealthcheck.yaml index 6dc5d09180..70b8488ff9 100644 --- a/crds/compute_v1beta1_computehttphealthcheck.yaml +++ b/crds/compute_v1beta1_computehttphealthcheck.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computehttpshealthcheck.yaml b/crds/compute_v1beta1_computehttpshealthcheck.yaml index b4e292cd37..790c4a97d8 100644 --- a/crds/compute_v1beta1_computehttpshealthcheck.yaml +++ b/crds/compute_v1beta1_computehttpshealthcheck.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeimage.yaml b/crds/compute_v1beta1_computeimage.yaml index d5df341776..ba673c9a6f 100644 --- a/crds/compute_v1beta1_computeimage.yaml +++ b/crds/compute_v1beta1_computeimage.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinstance.yaml b/crds/compute_v1beta1_computeinstance.yaml index 02a10a5a79..83e8d09ae8 100644 --- a/crds/compute_v1beta1_computeinstance.yaml +++ b/crds/compute_v1beta1_computeinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinstancegroup.yaml b/crds/compute_v1beta1_computeinstancegroup.yaml index 886ae6dc24..125c528c95 100644 --- a/crds/compute_v1beta1_computeinstancegroup.yaml +++ b/crds/compute_v1beta1_computeinstancegroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinstancegroupmanager.yaml b/crds/compute_v1beta1_computeinstancegroupmanager.yaml index 9ec6f76f2b..f7f989a009 100644 --- a/crds/compute_v1beta1_computeinstancegroupmanager.yaml +++ b/crds/compute_v1beta1_computeinstancegroupmanager.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -338,17 +338,15 @@ spec: groups, proactive redistribution is disabled.' type: string maxSurge: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: The maximum number of instances that can be created + above the specified `targetSize` during the update process. + This value can be either a fixed number or, if the group has + 10 or more instances, a percentage. If you set a percentage, + the number of instances is rounded if necessary. The default + value for `maxSurge` is a fixed value equal to the number of + zones in which the managed instance group operates. At least + one of either `maxSurge` or `maxUnavailable` must be greater + than 0. Learn more about [`maxSurge`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_surge). properties: fixed: description: Specifies a fixed number of VM instances. This @@ -362,17 +360,21 @@ spec: type: integer type: object maxUnavailable: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: 'The maximum number of instances that can be unavailable + during the update process. An instance is considered available + if all of the following conditions are satisfied: - The instance''s + [status](/compute/docs/instances/checking-instance-status) is + `RUNNING`. - If there is a [health check](/compute/docs/instance-groups/autohealing-instances-in-migs) + on the instance group, the instance''s health check status must + be `HEALTHY` at least once. If there is no health check on the + group, then the instance only needs to have a status of `RUNNING` + to be considered available. This value can be either a fixed + number or, if the group has 10 or more instances, a percentage. + If you set a percentage, the number of instances is rounded + if necessary. The default value for `maxUnavailable` is a fixed + value equal to the number of zones in which the managed instance + group operates. At least one of either `maxSurge` or `maxUnavailable` + must be greater than 0. Learn more about [`maxUnavailable`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_unavailable).' properties: fixed: description: Specifies a fixed number of VM instances. This diff --git a/crds/compute_v1beta1_computeinstancetemplate.yaml b/crds/compute_v1beta1_computeinstancetemplate.yaml index 2f74674033..eefdc054fe 100644 --- a/crds/compute_v1beta1_computeinstancetemplate.yaml +++ b/crds/compute_v1beta1_computeinstancetemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinterconnectattachment.yaml b/crds/compute_v1beta1_computeinterconnectattachment.yaml index c2de84216b..8d03e61604 100644 --- a/crds/compute_v1beta1_computeinterconnectattachment.yaml +++ b/crds/compute_v1beta1_computeinterconnectattachment.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenetwork.yaml b/crds/compute_v1beta1_computenetwork.yaml index ff40f38f56..36c408460f 100644 --- a/crds/compute_v1beta1_computenetwork.yaml +++ b/crds/compute_v1beta1_computenetwork.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenetworkendpointgroup.yaml b/crds/compute_v1beta1_computenetworkendpointgroup.yaml index d7469c8ae6..e0e32b30f5 100644 --- a/crds/compute_v1beta1_computenetworkendpointgroup.yaml +++ b/crds/compute_v1beta1_computenetworkendpointgroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenetworkpeering.yaml b/crds/compute_v1beta1_computenetworkpeering.yaml index 38e00db242..cdc05741de 100644 --- a/crds/compute_v1beta1_computenetworkpeering.yaml +++ b/crds/compute_v1beta1_computenetworkpeering.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenodegroup.yaml b/crds/compute_v1beta1_computenodegroup.yaml index e354a6014a..5c09f702da 100644 --- a/crds/compute_v1beta1_computenodegroup.yaml +++ b/crds/compute_v1beta1_computenodegroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenodetemplate.yaml b/crds/compute_v1beta1_computenodetemplate.yaml index 0379235aab..fa70a1e9cc 100644 --- a/crds/compute_v1beta1_computenodetemplate.yaml +++ b/crds/compute_v1beta1_computenodetemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computepacketmirroring.yaml b/crds/compute_v1beta1_computepacketmirroring.yaml index a9f2aa2d7d..b040ae5c53 100644 --- a/crds/compute_v1beta1_computepacketmirroring.yaml +++ b/crds/compute_v1beta1_computepacketmirroring.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computeprojectmetadata.yaml b/crds/compute_v1beta1_computeprojectmetadata.yaml index 0dfd968df7..bbffb8a9ec 100644 --- a/crds/compute_v1beta1_computeprojectmetadata.yaml +++ b/crds/compute_v1beta1_computeprojectmetadata.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computereservation.yaml b/crds/compute_v1beta1_computereservation.yaml index 228b9c47f9..059ac27217 100644 --- a/crds/compute_v1beta1_computereservation.yaml +++ b/crds/compute_v1beta1_computereservation.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeresourcepolicy.yaml b/crds/compute_v1beta1_computeresourcepolicy.yaml index ef045fe42e..a83dbcc355 100644 --- a/crds/compute_v1beta1_computeresourcepolicy.yaml +++ b/crds/compute_v1beta1_computeresourcepolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeroute.yaml b/crds/compute_v1beta1_computeroute.yaml index 27fbaa6c21..726b5167b5 100644 --- a/crds/compute_v1beta1_computeroute.yaml +++ b/crds/compute_v1beta1_computeroute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouter.yaml b/crds/compute_v1beta1_computerouter.yaml index 9ac94285fa..1fc9bb150d 100644 --- a/crds/compute_v1beta1_computerouter.yaml +++ b/crds/compute_v1beta1_computerouter.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouterinterface.yaml b/crds/compute_v1beta1_computerouterinterface.yaml index 32f532226d..982c8f8ee0 100644 --- a/crds/compute_v1beta1_computerouterinterface.yaml +++ b/crds/compute_v1beta1_computerouterinterface.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouternat.yaml b/crds/compute_v1beta1_computerouternat.yaml index 381e055a52..6bb76ad4be 100644 --- a/crds/compute_v1beta1_computerouternat.yaml +++ b/crds/compute_v1beta1_computerouternat.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouterpeer.yaml b/crds/compute_v1beta1_computerouterpeer.yaml index 5d7a4fa206..9c7d67d10a 100644 --- a/crds/compute_v1beta1_computerouterpeer.yaml +++ b/crds/compute_v1beta1_computerouterpeer.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesecuritypolicy.yaml b/crds/compute_v1beta1_computesecuritypolicy.yaml index 38f09e9802..78fb99ce74 100644 --- a/crds/compute_v1beta1_computesecuritypolicy.yaml +++ b/crds/compute_v1beta1_computesecuritypolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeserviceattachment.yaml b/crds/compute_v1beta1_computeserviceattachment.yaml index b575a60ca4..e96905111d 100644 --- a/crds/compute_v1beta1_computeserviceattachment.yaml +++ b/crds/compute_v1beta1_computeserviceattachment.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computesharedvpchostproject.yaml b/crds/compute_v1beta1_computesharedvpchostproject.yaml index 7aac4b1a03..be95735286 100644 --- a/crds/compute_v1beta1_computesharedvpchostproject.yaml +++ b/crds/compute_v1beta1_computesharedvpchostproject.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesharedvpcserviceproject.yaml b/crds/compute_v1beta1_computesharedvpcserviceproject.yaml index c6ac61724c..721ccf8def 100644 --- a/crds/compute_v1beta1_computesharedvpcserviceproject.yaml +++ b/crds/compute_v1beta1_computesharedvpcserviceproject.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesnapshot.yaml b/crds/compute_v1beta1_computesnapshot.yaml index d3d0b234fa..5dc1b9e49c 100644 --- a/crds/compute_v1beta1_computesnapshot.yaml +++ b/crds/compute_v1beta1_computesnapshot.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesslcertificate.yaml b/crds/compute_v1beta1_computesslcertificate.yaml index 0b556fe50a..a3ec4230f3 100644 --- a/crds/compute_v1beta1_computesslcertificate.yaml +++ b/crds/compute_v1beta1_computesslcertificate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesslpolicy.yaml b/crds/compute_v1beta1_computesslpolicy.yaml index 5e50cf445f..2fbef9760e 100644 --- a/crds/compute_v1beta1_computesslpolicy.yaml +++ b/crds/compute_v1beta1_computesslpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesubnetwork.yaml b/crds/compute_v1beta1_computesubnetwork.yaml index 52b57b3e5d..6849c9f7ce 100644 --- a/crds/compute_v1beta1_computesubnetwork.yaml +++ b/crds/compute_v1beta1_computesubnetwork.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetgrpcproxy.yaml b/crds/compute_v1beta1_computetargetgrpcproxy.yaml index 0bf589ac55..b56cd2bcea 100644 --- a/crds/compute_v1beta1_computetargetgrpcproxy.yaml +++ b/crds/compute_v1beta1_computetargetgrpcproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargethttpproxy.yaml b/crds/compute_v1beta1_computetargethttpproxy.yaml index bff7350acf..23857f8180 100644 --- a/crds/compute_v1beta1_computetargethttpproxy.yaml +++ b/crds/compute_v1beta1_computetargethttpproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargethttpsproxy.yaml b/crds/compute_v1beta1_computetargethttpsproxy.yaml index 6de1c91030..138a56468f 100644 --- a/crds/compute_v1beta1_computetargethttpsproxy.yaml +++ b/crds/compute_v1beta1_computetargethttpsproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetinstance.yaml b/crds/compute_v1beta1_computetargetinstance.yaml index d4eae386d9..24cc31ddbd 100644 --- a/crds/compute_v1beta1_computetargetinstance.yaml +++ b/crds/compute_v1beta1_computetargetinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetpool.yaml b/crds/compute_v1beta1_computetargetpool.yaml index 2e34e1f35a..5bff533c4b 100644 --- a/crds/compute_v1beta1_computetargetpool.yaml +++ b/crds/compute_v1beta1_computetargetpool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetsslproxy.yaml b/crds/compute_v1beta1_computetargetsslproxy.yaml index cc34e2d6e7..ab5970de01 100644 --- a/crds/compute_v1beta1_computetargetsslproxy.yaml +++ b/crds/compute_v1beta1_computetargetsslproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargettcpproxy.yaml b/crds/compute_v1beta1_computetargettcpproxy.yaml index 630c55c313..f4833ee5c7 100644 --- a/crds/compute_v1beta1_computetargettcpproxy.yaml +++ b/crds/compute_v1beta1_computetargettcpproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetvpngateway.yaml b/crds/compute_v1beta1_computetargetvpngateway.yaml index d5e0c5d584..b9adb4741a 100644 --- a/crds/compute_v1beta1_computetargetvpngateway.yaml +++ b/crds/compute_v1beta1_computetargetvpngateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeurlmap.yaml b/crds/compute_v1beta1_computeurlmap.yaml index 4373e57bc7..10212e4d27 100644 --- a/crds/compute_v1beta1_computeurlmap.yaml +++ b/crds/compute_v1beta1_computeurlmap.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computevpngateway.yaml b/crds/compute_v1beta1_computevpngateway.yaml index e3303d2d61..9e40344fd2 100644 --- a/crds/compute_v1beta1_computevpngateway.yaml +++ b/crds/compute_v1beta1_computevpngateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computevpntunnel.yaml b/crds/compute_v1beta1_computevpntunnel.yaml index 272fb25384..fb6d4ad5fa 100644 --- a/crds/compute_v1beta1_computevpntunnel.yaml +++ b/crds/compute_v1beta1_computevpntunnel.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/configcontroller_v1beta1_configcontrollerinstance.yaml b/crds/configcontroller_v1beta1_configcontrollerinstance.yaml index db238651ab..a454d6c151 100644 --- a/crds/configcontroller_v1beta1_configcontrollerinstance.yaml +++ b/crds/configcontroller_v1beta1_configcontrollerinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/container_v1beta1_containercluster.yaml b/crds/container_v1beta1_containercluster.yaml index 39dbdd82a9..74a6f2aea5 100644 --- a/crds/container_v1beta1_containercluster.yaml +++ b/crds/container_v1beta1_containercluster.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/container_v1beta1_containernodepool.yaml b/crds/container_v1beta1_containernodepool.yaml index efaa7e1fd3..c923486a83 100644 --- a/crds/container_v1beta1_containernodepool.yaml +++ b/crds/container_v1beta1_containernodepool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/containeranalysis_v1beta1_containeranalysisnote.yaml b/crds/containeranalysis_v1beta1_containeranalysisnote.yaml index 78e3b99784..57aa9625e2 100644 --- a/crds/containeranalysis_v1beta1_containeranalysisnote.yaml +++ b/crds/containeranalysis_v1beta1_containeranalysisnote.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml b/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml index 6d2eb8a62e..a450eca704 100644 --- a/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml +++ b/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/dataflow_v1beta1_dataflowjob.yaml b/crds/dataflow_v1beta1_dataflowjob.yaml index fc2ce442fa..5614989977 100644 --- a/crds/dataflow_v1beta1_dataflowjob.yaml +++ b/crds/dataflow_v1beta1_dataflowjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/datafusion_v1beta1_datafusioninstance.yaml b/crds/datafusion_v1beta1_datafusioninstance.yaml index 2e466aef96..b710c033f5 100644 --- a/crds/datafusion_v1beta1_datafusioninstance.yaml +++ b/crds/datafusion_v1beta1_datafusioninstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml b/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml index 095e4cb0d4..886dbe62d0 100644 --- a/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml +++ b/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataproc_v1beta1_dataproccluster.yaml b/crds/dataproc_v1beta1_dataproccluster.yaml index 5fd2d4df6c..01d9550ba1 100644 --- a/crds/dataproc_v1beta1_dataproccluster.yaml +++ b/crds/dataproc_v1beta1_dataproccluster.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml b/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml index 5dc8814aff..8a985d95e6 100644 --- a/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml +++ b/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dns_v1beta1_dnsmanagedzone.yaml b/crds/dns_v1beta1_dnsmanagedzone.yaml index 2345d6ac8d..9d29533c02 100644 --- a/crds/dns_v1beta1_dnsmanagedzone.yaml +++ b/crds/dns_v1beta1_dnsmanagedzone.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/dns_v1beta1_dnspolicy.yaml b/crds/dns_v1beta1_dnspolicy.yaml index 769f9de2a7..29d4eedfcc 100644 --- a/crds/dns_v1beta1_dnspolicy.yaml +++ b/crds/dns_v1beta1_dnspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/dns_v1beta1_dnsrecordset.yaml b/crds/dns_v1beta1_dnsrecordset.yaml index a4335854c2..b34dc326ed 100644 --- a/crds/dns_v1beta1_dnsrecordset.yaml +++ b/crds/dns_v1beta1_dnsrecordset.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/eventarc_v1beta1_eventarctrigger.yaml b/crds/eventarc_v1beta1_eventarctrigger.yaml index d05da616cb..e54fa6d3c2 100644 --- a/crds/eventarc_v1beta1_eventarctrigger.yaml +++ b/crds/eventarc_v1beta1_eventarctrigger.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -228,7 +228,7 @@ spec: properties: external: description: |- - Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts?hl=en#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. + Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. Allowed value: The `email` field of an `IAMServiceAccount` resource. type: string diff --git a/crds/filestore_v1beta1_filestorebackup.yaml b/crds/filestore_v1beta1_filestorebackup.yaml index 0e5081c868..717eaca9a4 100644 --- a/crds/filestore_v1beta1_filestorebackup.yaml +++ b/crds/filestore_v1beta1_filestorebackup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/filestore_v1beta1_filestoreinstance.yaml b/crds/filestore_v1beta1_filestoreinstance.yaml index a8472c958f..a2fd19a57b 100644 --- a/crds/filestore_v1beta1_filestoreinstance.yaml +++ b/crds/filestore_v1beta1_filestoreinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/firestore_v1beta1_firestoreindex.yaml b/crds/firestore_v1beta1_firestoreindex.yaml index a5a678f111..2f3a0a213c 100644 --- a/crds/firestore_v1beta1_firestoreindex.yaml +++ b/crds/firestore_v1beta1_firestoreindex.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/gameservices_v1beta1_gameservicesrealm.yaml b/crds/gameservices_v1beta1_gameservicesrealm.yaml index 85bcde1107..d8e6fe89d7 100644 --- a/crds/gameservices_v1beta1_gameservicesrealm.yaml +++ b/crds/gameservices_v1beta1_gameservicesrealm.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/gkehub_v1beta1_gkehubfeature.yaml b/crds/gkehub_v1beta1_gkehubfeature.yaml index c04dacd1fa..262b1c1e82 100644 --- a/crds/gkehub_v1beta1_gkehubfeature.yaml +++ b/crds/gkehub_v1beta1_gkehubfeature.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml b/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml index ad0f389b32..0d38b49fdc 100644 --- a/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml +++ b/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/gkehub_v1beta1_gkehubmembership.yaml b/crds/gkehub_v1beta1_gkehubmembership.yaml index c79b22f8b7..c75e59ce5d 100644 --- a/crds/gkehub_v1beta1_gkehubmembership.yaml +++ b/crds/gkehub_v1beta1_gkehubmembership.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iam_v1beta1_iamauditconfig.yaml b/crds/iam_v1beta1_iamauditconfig.yaml index b2100da824..b912c2caf8 100644 --- a/crds/iam_v1beta1_iamauditconfig.yaml +++ b/crds/iam_v1beta1_iamauditconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamcustomrole.yaml b/crds/iam_v1beta1_iamcustomrole.yaml index f719472bb4..5bad008d62 100644 --- a/crds/iam_v1beta1_iamcustomrole.yaml +++ b/crds/iam_v1beta1_iamcustomrole.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iampartialpolicy.yaml b/crds/iam_v1beta1_iampartialpolicy.yaml index 87ed5c8190..e5ecab55ec 100644 --- a/crds/iam_v1beta1_iampartialpolicy.yaml +++ b/crds/iam_v1beta1_iampartialpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iampolicy.yaml b/crds/iam_v1beta1_iampolicy.yaml index c7090f7383..143f1d93a5 100644 --- a/crds/iam_v1beta1_iampolicy.yaml +++ b/crds/iam_v1beta1_iampolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iampolicymember.yaml b/crds/iam_v1beta1_iampolicymember.yaml index b0f2299da1..264eec8bbd 100644 --- a/crds/iam_v1beta1_iampolicymember.yaml +++ b/crds/iam_v1beta1_iampolicymember.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamserviceaccount.yaml b/crds/iam_v1beta1_iamserviceaccount.yaml index 70909bf834..dc10918e9e 100644 --- a/crds/iam_v1beta1_iamserviceaccount.yaml +++ b/crds/iam_v1beta1_iamserviceaccount.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamserviceaccountkey.yaml b/crds/iam_v1beta1_iamserviceaccountkey.yaml index 5ed1ef71f6..f0b8b282e8 100644 --- a/crds/iam_v1beta1_iamserviceaccountkey.yaml +++ b/crds/iam_v1beta1_iamserviceaccountkey.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamworkloadidentitypool.yaml b/crds/iam_v1beta1_iamworkloadidentitypool.yaml index 90e22bb786..a0fc8daab3 100644 --- a/crds/iam_v1beta1_iamworkloadidentitypool.yaml +++ b/crds/iam_v1beta1_iamworkloadidentitypool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml b/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml index b66a7a01ec..a48a2b9c2b 100644 --- a/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml +++ b/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iap_v1beta1_iapbrand.yaml b/crds/iap_v1beta1_iapbrand.yaml index 8dc394cbbe..161cf843fd 100644 --- a/crds/iap_v1beta1_iapbrand.yaml +++ b/crds/iap_v1beta1_iapbrand.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iap_v1beta1_iapidentityawareproxyclient.yaml b/crds/iap_v1beta1_iapidentityawareproxyclient.yaml index 5d1b8d4fe6..bda8ea1066 100644 --- a/crds/iap_v1beta1_iapidentityawareproxyclient.yaml +++ b/crds/iap_v1beta1_iapidentityawareproxyclient.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/identityplatform_v1beta1_identityplatformconfig.yaml b/crds/identityplatform_v1beta1_identityplatformconfig.yaml new file mode 100644 index 0000000000..ab6ee653bb --- /dev/null +++ b/crds/identityplatform_v1beta1_identityplatformconfig.yaml @@ -0,0 +1,704 @@ +# Copyright 2020 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.77.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: identityplatformconfigs.identityplatform.cnrm.cloud.google.com +spec: + group: identityplatform.cnrm.cloud.google.com + names: + categories: + - gcp + kind: IdentityPlatformConfig + plural: identityplatformconfigs + shortNames: + - gcpidentityplatformconfig + - gcpidentityplatformconfigs + singular: identityplatformconfig + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + properties: + authorizedDomains: + description: List of domains authorized for OAuth redirects + items: + type: string + type: array + blockingFunctions: + description: Configuration related to blocking functions. + properties: + triggers: + additionalProperties: + properties: + functionUriRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + HTTP URI trigger for the Cloud Function. + + Allowed value: The `httpsTrigger.url` field of a `CloudFunctionsFunction` resource. + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + updateTime: + description: When the trigger was changed. + format: date-time + type: string + type: object + description: 'Map of Trigger to event type. Key should be one + of the supported event types: "beforeCreate", "beforeSignIn"' + type: object + type: object + client: + description: Options related to how clients making requests on behalf + of a project should be configured. + properties: + permissions: + description: Configuration related to restricting a user's ability + to affect their account. + properties: + disabledUserDeletion: + description: When true, end users cannot delete their account + on the associated project through any of our API methods + type: boolean + disabledUserSignup: + description: When true, end users cannot sign up for a new + account on the associated project through any of our API + methods + type: boolean + type: object + type: object + mfa: + description: Configuration for this project's multi-factor authentication, + including whether it is active and what factors can be used for + the second factor + properties: + state: + description: 'Whether MultiFactor Authentication has been enabled + for this project. Possible values: STATE_UNSPECIFIED, DISABLED, + ENABLED, MANDATORY' + type: string + type: object + monitoring: + description: Configuration related to monitoring project activity. + properties: + requestLogging: + description: Configuration for logging requests made to this project + to Stackdriver Logging + properties: + enabled: + description: Whether logging is enabled for this project or + not. + type: boolean + type: object + type: object + multiTenant: + description: Configuration related to multi-tenant functionality. + properties: + allowTenants: + description: Whether this project can have tenants or not. + type: boolean + defaultTenantLocationRef: + oneOf: + - not: + required: + - external + required: + - name + - kind + - not: + anyOf: + - required: + - name + - required: + - namespace + - required: + - kind + required: + - external + properties: + external: + description: |- + The default cloud parent org or folder that the tenant project should be created under. The parent resource name should be in the format of "/", such as "folders/123" or "organizations/456". If the value is not set, the tenant will be created under the same organization or folder as the agent project. + + Allowed values: + * The Google Cloud resource name of a `Folder` resource (format: `folders/{{name}}`). + * The Google Cloud resource name of a Google Cloud Organization (format: `organizations/{{name}}`). + type: string + kind: + description: 'Kind of the referent. Allowed values: Folder' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + type: object + notification: + description: Configuration related to sending notifications to users. + properties: + defaultLocale: + description: Default locale used for email and SMS in IETF BCP + 47 format. + type: string + sendEmail: + description: Options for email sending. + properties: + callbackUri: + description: action url in email template. + type: string + changeEmailTemplate: + description: Email template for change email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + dnsInfo: + description: Information of custom domain DNS verification. + properties: + useCustomDomain: + description: Whether to use custom domain. + type: boolean + type: object + method: + description: 'The method used for sending an email. Possible + values: METHOD_UNSPECIFIED, DEFAULT, CUSTOM_SMTP' + type: string + resetPasswordTemplate: + description: Email template for reset password + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + revertSecondFactorAdditionTemplate: + description: Email template for reverting second factor addition + emails + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + smtp: + description: Use a custom SMTP relay + properties: + host: + description: SMTP relay host + type: string + password: + description: SMTP relay password + oneOf: + - not: + required: + - valueFrom + required: + - value + - not: + required: + - value + required: + - valueFrom + properties: + value: + description: Value of the field. Cannot be used if + 'valueFrom' is specified. + type: string + valueFrom: + description: Source for the field's value. Cannot + be used if 'value' is specified. + properties: + secretKeyRef: + description: Reference to a value with the given + key in the given Secret in the resource's namespace. + properties: + key: + description: Key that identifies the value + to be extracted. + type: string + name: + description: Name of the Secret to extract + a value from. + type: string + required: + - name + - key + type: object + type: object + type: object + port: + description: SMTP relay port + format: int64 + type: integer + securityMode: + description: 'SMTP security mode. Possible values: SECURITY_MODE_UNSPECIFIED, + SSL, START_TLS' + type: string + senderEmail: + description: Sender email for the SMTP relay + type: string + username: + description: SMTP relay username + type: string + type: object + verifyEmailTemplate: + description: Email template for verify email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + type: object + sendSms: + description: Options for SMS sending. + properties: + useDeviceLocale: + description: Whether to use the accept_language header for + SMS. + type: boolean + type: object + type: object + projectRef: + description: The Project that this resource belongs to. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + The project of the resource + + Allowed value: The Google Cloud resource name of a `Project` resource (format: `projects/{{name}}`). + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + quota: + description: Configuration related to quotas. + properties: + signUpQuotaConfig: + description: Quota for the Signup endpoint, if overwritten. Signup + quota is measured in sign ups per project per hour per IP. + properties: + quota: + description: Corresponds to the 'refill_token_count' field + in QuotaServer config + format: int64 + type: integer + quotaDuration: + description: How long this quota will be active for + type: string + startTime: + description: When this quota will take affect + format: date-time + type: string + type: object + type: object + signIn: + description: Configuration related to local sign in methods. + properties: + allowDuplicateEmails: + description: Whether to allow more than one account to have the + same email. + type: boolean + anonymous: + description: Configuration options related to authenticating an + anonymous user. + properties: + enabled: + description: Whether anonymous user auth is enabled for the + project or not. + type: boolean + type: object + email: + description: Configuration options related to authenticating a + user by their email address. + properties: + enabled: + description: Whether email auth is enabled for the project + or not. + type: boolean + passwordRequired: + description: Whether a password is required for email auth + or not. If true, both an email and password must be provided + to sign in. If false, a user may sign in via either email/password + or email link. + type: boolean + type: object + phoneNumber: + description: Configuration options related to authenticated a + user by their phone number. + properties: + enabled: + description: Whether phone number auth is enabled for the + project or not. + type: boolean + testPhoneNumbers: + additionalProperties: + type: string + description: A map of that can be used for phone auth testing. + type: object + type: object + type: object + required: + - projectRef + type: object + status: + properties: + client: + properties: + apiKey: + description: Output only. API key that can be used when making + requests for this project. + type: string + firebaseSubdomain: + description: Output only. Firebase subdomain. + type: string + type: object + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + notification: + properties: + sendEmail: + properties: + changeEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + dnsInfo: + properties: + customDomain: + description: Output only. The applied verified custom + domain. + type: string + customDomainState: + description: 'Output only. The current verification state + of the custom domain. The custom domain will only be + used once the domain verification is successful. Possible + values: VERIFICATION_STATE_UNSPECIFIED, NOT_STARTED, + IN_PROGRESS, FAILED, SUCCEEDED' + type: string + domainVerificationRequestTime: + description: Output only. The timestamp of initial request + for the current domain verification. + format: date-time + type: string + pendingCustomDomain: + description: Output only. The custom domain that's to + be verified. + type: string + type: object + resetPasswordTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + revertSecondFactorAdditionTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + verifyEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + type: object + sendSms: + properties: + smsTemplate: + description: Output only. The template to use when sending + an SMS. + properties: + content: + description: 'Output only. The SMS''s content. Can contain + the following placeholders which will be replaced with + the appropriate values: %APP_NAME% - For Android or + iOS apps, the app''s display name. For web apps, the + domain hosting the application. %LOGIN_CODE% - The OOB + code being sent in the SMS.' + type: string + type: object + type: object + type: object + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + signIn: + properties: + email: + properties: + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, + MD5, HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, + SHA512, STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation + algorithms. See https://tools.ietf.org/html/rfc7914 + for explanation of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation + algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be + inserted between the salt and plain text password in + base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, MD5, + HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, SHA512, + STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation algorithms. + See https://tools.ietf.org/html/rfc7914 for explanation + of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be inserted + between the salt and plain text password in base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + subtype: + description: 'Output only. The subtype of this config. Possible values: + SUBTYPE_UNSPECIFIED, IDENTITY_PLATFORM, FIREBASE_AUTH' + type: string + type: object + required: + - spec + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] diff --git a/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml b/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml index d65732a776..0417761332 100644 --- a/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml +++ b/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/identityplatform_v1beta1_identityplatformtenant.yaml b/crds/identityplatform_v1beta1_identityplatformtenant.yaml index 499011922b..33bb4ed891 100644 --- a/crds/identityplatform_v1beta1_identityplatformtenant.yaml +++ b/crds/identityplatform_v1beta1_identityplatformtenant.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml b/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml index f97887486f..fd4808753d 100644 --- a/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml +++ b/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/kms_v1beta1_kmscryptokey.yaml b/crds/kms_v1beta1_kmscryptokey.yaml index 9b7877b563..aba5a769d2 100644 --- a/crds/kms_v1beta1_kmscryptokey.yaml +++ b/crds/kms_v1beta1_kmscryptokey.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/kms_v1beta1_kmskeyring.yaml b/crds/kms_v1beta1_kmskeyring.yaml index 92b6a35b08..dce01c33b9 100644 --- a/crds/kms_v1beta1_kmskeyring.yaml +++ b/crds/kms_v1beta1_kmskeyring.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/logging_v1beta1_logginglogbucket.yaml b/crds/logging_v1beta1_logginglogbucket.yaml index 73969e3a6c..12cda0a055 100644 --- a/crds/logging_v1beta1_logginglogbucket.yaml +++ b/crds/logging_v1beta1_logginglogbucket.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/logging_v1beta1_logginglogexclusion.yaml b/crds/logging_v1beta1_logginglogexclusion.yaml index f0ee5ae08d..7498b36328 100644 --- a/crds/logging_v1beta1_logginglogexclusion.yaml +++ b/crds/logging_v1beta1_logginglogexclusion.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/logging_v1beta1_logginglogmetric.yaml b/crds/logging_v1beta1_logginglogmetric.yaml index 25e1f31e3e..cb068281ee 100644 --- a/crds/logging_v1beta1_logginglogmetric.yaml +++ b/crds/logging_v1beta1_logginglogmetric.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/logging_v1beta1_logginglogsink.yaml b/crds/logging_v1beta1_logginglogsink.yaml index e7c4a70d5c..5c8bc9b620 100644 --- a/crds/logging_v1beta1_logginglogsink.yaml +++ b/crds/logging_v1beta1_logginglogsink.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/logging_v1beta1_logginglogview.yaml b/crds/logging_v1beta1_logginglogview.yaml index eeeb3f63bb..a0d49ce1d5 100644 --- a/crds/logging_v1beta1_logginglogview.yaml +++ b/crds/logging_v1beta1_logginglogview.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/memcache_v1beta1_memcacheinstance.yaml b/crds/memcache_v1beta1_memcacheinstance.yaml index c32bf29a2b..760f44319d 100644 --- a/crds/memcache_v1beta1_memcacheinstance.yaml +++ b/crds/memcache_v1beta1_memcacheinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/monitoring_v1beta1_monitoringalertpolicy.yaml b/crds/monitoring_v1beta1_monitoringalertpolicy.yaml index 15b0f5b1c2..49a11b46dc 100644 --- a/crds/monitoring_v1beta1_monitoringalertpolicy.yaml +++ b/crds/monitoring_v1beta1_monitoringalertpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/monitoring_v1beta1_monitoringdashboard.yaml b/crds/monitoring_v1beta1_monitoringdashboard.yaml index 1421dbf536..bb49bf5969 100644 --- a/crds/monitoring_v1beta1_monitoringdashboard.yaml +++ b/crds/monitoring_v1beta1_monitoringdashboard.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -1798,7 +1798,6 @@ spec: description: The informational elements that are arranged into the columns row-first. items: - description: The informational widget contained in the tile. properties: blank: description: A blank space. @@ -4977,8 +4976,6 @@ spec: description: The display widgets arranged horizontally in this row. items: - description: The informational widget contained in the - tile. properties: blank: description: A blank space. diff --git a/crds/monitoring_v1beta1_monitoringgroup.yaml b/crds/monitoring_v1beta1_monitoringgroup.yaml index 63128211c5..1f6475e5d9 100644 --- a/crds/monitoring_v1beta1_monitoringgroup.yaml +++ b/crds/monitoring_v1beta1_monitoringgroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml b/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml index d20d9ec637..5f6e350bae 100644 --- a/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml +++ b/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml b/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml index 9b470f4ea3..7ae8235e9a 100644 --- a/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ b/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/monitoring_v1beta1_monitoringservice.yaml b/crds/monitoring_v1beta1_monitoringservice.yaml index 4ac206f9c1..ab3230984a 100644 --- a/crds/monitoring_v1beta1_monitoringservice.yaml +++ b/crds/monitoring_v1beta1_monitoringservice.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml index 33715c1def..56cab35bf0 100644 --- a/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ b/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml b/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml index 04e38a3d84..05dab79be4 100644 --- a/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml +++ b/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml b/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml index a555c0c11c..3f0d95ae17 100644 --- a/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml +++ b/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml b/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml index 4dcc01fbc7..2a4f7ad672 100644 --- a/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml +++ b/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml b/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml index eebec685d1..b99c24ecae 100644 --- a/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml +++ b/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml b/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml index ad8c42d9ed..a3e82ca242 100644 --- a/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml +++ b/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml b/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml index 574c439d50..f786ef71f6 100644 --- a/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml +++ b/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml b/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml index 393233c0ec..6027df42ee 100644 --- a/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml +++ b/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesgateway.yaml b/crds/networkservices_v1beta1_networkservicesgateway.yaml index bf0dd45770..77e4f56037 100644 --- a/crds/networkservices_v1beta1_networkservicesgateway.yaml +++ b/crds/networkservices_v1beta1_networkservicesgateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml b/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml index 200a1bb28f..ba621944fa 100644 --- a/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml +++ b/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkserviceshttproute.yaml b/crds/networkservices_v1beta1_networkserviceshttproute.yaml index 0102b72fa0..8dbe61b56e 100644 --- a/crds/networkservices_v1beta1_networkserviceshttproute.yaml +++ b/crds/networkservices_v1beta1_networkserviceshttproute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesmesh.yaml b/crds/networkservices_v1beta1_networkservicesmesh.yaml index 25a129eefc..4149a7b396 100644 --- a/crds/networkservices_v1beta1_networkservicesmesh.yaml +++ b/crds/networkservices_v1beta1_networkservicesmesh.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicestcproute.yaml b/crds/networkservices_v1beta1_networkservicestcproute.yaml index af3017e0a8..45864b3c76 100644 --- a/crds/networkservices_v1beta1_networkservicestcproute.yaml +++ b/crds/networkservices_v1beta1_networkservicestcproute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/osconfig_v1beta1_osconfigguestpolicy.yaml b/crds/osconfig_v1beta1_osconfigguestpolicy.yaml index 09130488b4..f1fca3e776 100644 --- a/crds/osconfig_v1beta1_osconfigguestpolicy.yaml +++ b/crds/osconfig_v1beta1_osconfigguestpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml b/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml index a6457c1608..fb42edb32a 100644 --- a/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml +++ b/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/privateca_v1beta1_privatecacapool.yaml b/crds/privateca_v1beta1_privatecacapool.yaml index 1fc9a21e8a..b250a5fa71 100644 --- a/crds/privateca_v1beta1_privatecacapool.yaml +++ b/crds/privateca_v1beta1_privatecacapool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/privateca_v1beta1_privatecacertificateauthority.yaml b/crds/privateca_v1beta1_privatecacertificateauthority.yaml index a6d5562aa8..636a51d144 100644 --- a/crds/privateca_v1beta1_privatecacertificateauthority.yaml +++ b/crds/privateca_v1beta1_privatecacertificateauthority.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/privateca_v1beta1_privatecacertificatetemplate.yaml b/crds/privateca_v1beta1_privatecacertificatetemplate.yaml index 56702e8742..5ddfb6e7d9 100644 --- a/crds/privateca_v1beta1_privatecacertificatetemplate.yaml +++ b/crds/privateca_v1beta1_privatecacertificatetemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/pubsub_v1beta1_pubsubsubscription.yaml b/crds/pubsub_v1beta1_pubsubsubscription.yaml index 95633f7aad..605daa5055 100644 --- a/crds/pubsub_v1beta1_pubsubsubscription.yaml +++ b/crds/pubsub_v1beta1_pubsubsubscription.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/pubsub_v1beta1_pubsubtopic.yaml b/crds/pubsub_v1beta1_pubsubtopic.yaml index 893730ba6d..030a0e3066 100644 --- a/crds/pubsub_v1beta1_pubsubtopic.yaml +++ b/crds/pubsub_v1beta1_pubsubtopic.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml b/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml index 565bfdcb8b..fd9f7b4d54 100644 --- a/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml +++ b/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/redis_v1beta1_redisinstance.yaml b/crds/redis_v1beta1_redisinstance.yaml index af765a2ec2..2412de001f 100644 --- a/crds/redis_v1beta1_redisinstance.yaml +++ b/crds/redis_v1beta1_redisinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_folder.yaml b/crds/resourcemanager_v1beta1_folder.yaml index 9e42c3965f..51e4b445bd 100644 --- a/crds/resourcemanager_v1beta1_folder.yaml +++ b/crds/resourcemanager_v1beta1_folder.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_project.yaml b/crds/resourcemanager_v1beta1_project.yaml index cf9df1df08..5afdc3ddd2 100644 --- a/crds/resourcemanager_v1beta1_project.yaml +++ b/crds/resourcemanager_v1beta1_project.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml b/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml index 32c639b681..964ac8d4ae 100644 --- a/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml +++ b/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml b/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml index b4c8f07962..dcf4972012 100644 --- a/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml +++ b/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/run_v1beta1_runservice.yaml b/crds/run_v1beta1_runservice.yaml index b5d08a1249..a26d9724a2 100644 --- a/crds/run_v1beta1_runservice.yaml +++ b/crds/run_v1beta1_runservice.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/secretmanager_v1beta1_secretmanagersecret.yaml b/crds/secretmanager_v1beta1_secretmanagersecret.yaml index 93b6365e97..d69dfd2ec9 100644 --- a/crds/secretmanager_v1beta1_secretmanagersecret.yaml +++ b/crds/secretmanager_v1beta1_secretmanagersecret.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml b/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml index d7a48c25b6..5b0a671191 100644 --- a/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml +++ b/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml index b64f12638a..83f2a317aa 100644 --- a/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ b/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/serviceusage_v1beta1_service.yaml b/crds/serviceusage_v1beta1_service.yaml index 39f14c904f..85bbdda266 100644 --- a/crds/serviceusage_v1beta1_service.yaml +++ b/crds/serviceusage_v1beta1_service.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sourcerepo_v1beta1_sourcereporepository.yaml b/crds/sourcerepo_v1beta1_sourcereporepository.yaml index 910b89a503..533d4cc89e 100644 --- a/crds/sourcerepo_v1beta1_sourcereporepository.yaml +++ b/crds/sourcerepo_v1beta1_sourcereporepository.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/spanner_v1beta1_spannerdatabase.yaml b/crds/spanner_v1beta1_spannerdatabase.yaml index 7a7742a5c3..f5f778822b 100644 --- a/crds/spanner_v1beta1_spannerdatabase.yaml +++ b/crds/spanner_v1beta1_spannerdatabase.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/spanner_v1beta1_spannerinstance.yaml b/crds/spanner_v1beta1_spannerinstance.yaml index ccc001ee01..4d272e52fa 100644 --- a/crds/spanner_v1beta1_spannerinstance.yaml +++ b/crds/spanner_v1beta1_spannerinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqldatabase.yaml b/crds/sql_v1beta1_sqldatabase.yaml index f9d16506f8..d958d63a85 100644 --- a/crds/sql_v1beta1_sqldatabase.yaml +++ b/crds/sql_v1beta1_sqldatabase.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqlinstance.yaml b/crds/sql_v1beta1_sqlinstance.yaml index 994a1a8922..0f5d283c70 100644 --- a/crds/sql_v1beta1_sqlinstance.yaml +++ b/crds/sql_v1beta1_sqlinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqlsslcert.yaml b/crds/sql_v1beta1_sqlsslcert.yaml index f28ab09cf9..05560cfcca 100644 --- a/crds/sql_v1beta1_sqlsslcert.yaml +++ b/crds/sql_v1beta1_sqlsslcert.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqluser.yaml b/crds/sql_v1beta1_sqluser.yaml index c7c02ddd73..abb5d01840 100644 --- a/crds/sql_v1beta1_sqluser.yaml +++ b/crds/sql_v1beta1_sqluser.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagebucket.yaml b/crds/storage_v1beta1_storagebucket.yaml index eebd4d1dab..60c2b7a237 100644 --- a/crds/storage_v1beta1_storagebucket.yaml +++ b/crds/storage_v1beta1_storagebucket.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagebucketaccesscontrol.yaml b/crds/storage_v1beta1_storagebucketaccesscontrol.yaml index 8fef1be0d8..52b08729ff 100644 --- a/crds/storage_v1beta1_storagebucketaccesscontrol.yaml +++ b/crds/storage_v1beta1_storagebucketaccesscontrol.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml b/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml index b7338a03f1..b856a560fd 100644 --- a/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml +++ b/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagenotification.yaml b/crds/storage_v1beta1_storagenotification.yaml index 54fffea759..00ec70a532 100644 --- a/crds/storage_v1beta1_storagenotification.yaml +++ b/crds/storage_v1beta1_storagenotification.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storagetransfer_v1beta1_storagetransferjob.yaml b/crds/storagetransfer_v1beta1_storagetransferjob.yaml index bfeb795978..cca8c03d91 100644 --- a/crds/storagetransfer_v1beta1_storagetransferjob.yaml +++ b/crds/storagetransfer_v1beta1_storagetransferjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml b/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml index ecade45fb8..1f941e0c3a 100644 --- a/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml +++ b/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml b/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml index 0b69d990ee..dea4175075 100644 --- a/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml +++ b/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: Namespace metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-system @@ -25,7 +25,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-controller-manager @@ -35,7 +35,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -45,7 +45,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-resource-stats-recorder @@ -55,7 +55,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-manager @@ -65,7 +65,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-cnrm-system-role @@ -86,7 +86,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-cnrm-system-role @@ -107,7 +107,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -180,7 +180,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role @@ -230,7 +230,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-cluster-role @@ -288,7 +288,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-ns-role @@ -313,7 +313,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-role @@ -343,7 +343,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -411,7 +411,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role @@ -474,7 +474,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role-binding @@ -492,7 +492,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role-binding @@ -510,7 +510,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-admin-binding @@ -533,7 +533,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-binding @@ -550,7 +550,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-binding @@ -567,7 +567,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-watcher-binding @@ -584,7 +584,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-binding @@ -601,7 +601,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-binding @@ -618,7 +618,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -635,7 +635,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -657,7 +657,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -678,7 +678,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -696,7 +696,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -709,8 +709,8 @@ spec: - /configconnector/recorder env: - name: CONFIG_CONNECTOR_VERSION - value: 1.76.0 - image: gcr.io/cnrm-eap/recorder:eb26258 + value: 1.77.0 + image: gcr.io/cnrm-eap/recorder:32441bd imagePullPolicy: Always name: recorder ports: @@ -742,7 +742,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -757,7 +757,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -770,7 +770,7 @@ spec: valueFrom: fieldRef: fieldPath: metadata.namespace - image: gcr.io/cnrm-eap/webhook:eb26258 + image: gcr.io/cnrm-eap/webhook:32441bd imagePullPolicy: Always name: webhook ports: @@ -798,7 +798,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -813,7 +813,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -826,7 +826,7 @@ spec: env: - name: GOOGLE_APPLICATION_CREDENTIALS value: /var/secrets/google/key.json - image: gcr.io/cnrm-eap/controller:eb26258 + image: gcr.io/cnrm-eap/controller:32441bd imagePullPolicy: Always name: manager ports: @@ -861,7 +861,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -876,7 +876,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -884,7 +884,7 @@ spec: containers: - command: - /configconnector/deletiondefender - image: gcr.io/cnrm-eap/deletiondefender:eb26258 + image: gcr.io/cnrm-eap/deletiondefender:32441bd imagePullPolicy: Always name: deletiondefender ports: @@ -912,7 +912,7 @@ apiVersion: autoscaling/v2beta2 kind: HorizontalPodAutoscaler metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook diff --git a/install-bundles/install-bundle-gcp-identity/crds.yaml b/install-bundles/install-bundle-gcp-identity/crds.yaml index 6a58e1b691..227fc5456a 100644 --- a/install-bundles/install-bundle-gcp-identity/crds.yaml +++ b/install-bundles/install-bundle-gcp-identity/crds.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -402,7 +402,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -532,7 +532,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1724,7 +1724,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1904,7 +1904,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2253,7 +2253,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3088,7 +3088,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3529,7 +3529,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3706,7 +3706,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3911,7 +3911,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4108,7 +4108,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4270,7 +4270,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -4723,7 +4723,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -4990,7 +4990,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5063,9 +5063,6 @@ spec: type: array clusterAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5176,9 +5173,6 @@ spec: type: string istioServiceIdentityAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5229,9 +5223,6 @@ spec: type: object kubernetesNamespaceAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5281,9 +5272,6 @@ spec: type: object kubernetesServiceAccountAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5427,7 +5415,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -6465,7 +6453,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -6894,7 +6882,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7088,7 +7076,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7332,7 +7320,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7870,7 +7858,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8123,7 +8111,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8349,7 +8337,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -9408,7 +9396,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10025,7 +10013,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10171,7 +10159,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10391,7 +10379,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10581,7 +10569,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10870,7 +10858,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11250,7 +11238,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11884,7 +11872,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12348,7 +12336,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12509,7 +12497,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12670,7 +12658,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12949,7 +12937,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -13272,17 +13260,15 @@ spec: groups, proactive redistribution is disabled.' type: string maxSurge: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: The maximum number of instances that can be created + above the specified `targetSize` during the update process. + This value can be either a fixed number or, if the group has + 10 or more instances, a percentage. If you set a percentage, + the number of instances is rounded if necessary. The default + value for `maxSurge` is a fixed value equal to the number of + zones in which the managed instance group operates. At least + one of either `maxSurge` or `maxUnavailable` must be greater + than 0. Learn more about [`maxSurge`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_surge). properties: fixed: description: Specifies a fixed number of VM instances. This @@ -13296,17 +13282,21 @@ spec: type: integer type: object maxUnavailable: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: 'The maximum number of instances that can be unavailable + during the update process. An instance is considered available + if all of the following conditions are satisfied: - The instance''s + [status](/compute/docs/instances/checking-instance-status) is + `RUNNING`. - If there is a [health check](/compute/docs/instance-groups/autohealing-instances-in-migs) + on the instance group, the instance''s health check status must + be `HEALTHY` at least once. If there is no health check on the + group, then the instance only needs to have a status of `RUNNING` + to be considered available. This value can be either a fixed + number or, if the group has 10 or more instances, a percentage. + If you set a percentage, the number of instances is rounded + if necessary. The default value for `maxUnavailable` is a fixed + value equal to the number of zones in which the managed instance + group operates. At least one of either `maxSurge` or `maxUnavailable` + must be greater than 0. Learn more about [`maxUnavailable`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_unavailable).' properties: fixed: description: Specifies a fixed number of VM instances. This @@ -13691,7 +13681,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13894,7 +13884,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -14783,7 +14773,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15519,7 +15509,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15845,7 +15835,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16053,7 +16043,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16248,7 +16238,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16398,7 +16388,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16607,7 +16597,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16788,7 +16778,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -17185,7 +17175,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17303,7 +17293,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17517,7 +17507,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17815,7 +17805,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18025,7 +18015,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18356,7 +18346,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18662,7 +18652,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18886,7 +18876,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19165,7 +19155,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19468,7 +19458,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -19814,7 +19804,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19920,7 +19910,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20059,7 +20049,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20438,7 +20428,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20653,7 +20643,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20816,7 +20806,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21104,7 +21094,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21282,7 +21272,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21452,7 +21442,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21696,7 +21686,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21892,7 +21882,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22118,7 +22108,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22346,7 +22336,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22513,7 +22503,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22674,7 +22664,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25385,7 +25375,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25584,7 +25574,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25956,7 +25946,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -26197,7 +26187,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -26787,7 +26777,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28047,7 +28037,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28596,7 +28586,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28722,7 +28712,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -29008,7 +28998,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -29286,7 +29276,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -29581,7 +29571,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30768,7 +30758,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -32633,7 +32623,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -32961,7 +32951,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -33157,7 +33147,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -33313,7 +33303,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -33526,7 +33516,7 @@ spec: properties: external: description: |- - Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts?hl=en#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. + Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. Allowed value: The `email` field of an `IAMServiceAccount` resource. type: string @@ -33667,7 +33657,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -33888,7 +33878,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34214,7 +34204,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34368,7 +34358,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34581,7 +34571,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34719,7 +34709,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35059,7 +35049,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35299,7 +35289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35664,7 +35654,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35825,7 +35815,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35965,7 +35955,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36262,7 +36252,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36490,7 +36480,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36704,7 +36694,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36883,7 +36873,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -37020,7 +37010,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37315,7 +37305,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37482,7 +37472,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37606,7 +37596,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37759,7 +37749,699 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: identityplatformconfigs.identityplatform.cnrm.cloud.google.com +spec: + group: identityplatform.cnrm.cloud.google.com + names: + categories: + - gcp + kind: IdentityPlatformConfig + plural: identityplatformconfigs + shortNames: + - gcpidentityplatformconfig + - gcpidentityplatformconfigs + singular: identityplatformconfig + preserveUnknownFields: false + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + properties: + authorizedDomains: + description: List of domains authorized for OAuth redirects + items: + type: string + type: array + blockingFunctions: + description: Configuration related to blocking functions. + properties: + triggers: + additionalProperties: + properties: + functionUriRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + HTTP URI trigger for the Cloud Function. + + Allowed value: The `httpsTrigger.url` field of a `CloudFunctionsFunction` resource. + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + updateTime: + description: When the trigger was changed. + format: date-time + type: string + type: object + description: 'Map of Trigger to event type. Key should be one + of the supported event types: "beforeCreate", "beforeSignIn"' + type: object + type: object + client: + description: Options related to how clients making requests on behalf + of a project should be configured. + properties: + permissions: + description: Configuration related to restricting a user's ability + to affect their account. + properties: + disabledUserDeletion: + description: When true, end users cannot delete their account + on the associated project through any of our API methods + type: boolean + disabledUserSignup: + description: When true, end users cannot sign up for a new + account on the associated project through any of our API + methods + type: boolean + type: object + type: object + mfa: + description: Configuration for this project's multi-factor authentication, + including whether it is active and what factors can be used for + the second factor + properties: + state: + description: 'Whether MultiFactor Authentication has been enabled + for this project. Possible values: STATE_UNSPECIFIED, DISABLED, + ENABLED, MANDATORY' + type: string + type: object + monitoring: + description: Configuration related to monitoring project activity. + properties: + requestLogging: + description: Configuration for logging requests made to this project + to Stackdriver Logging + properties: + enabled: + description: Whether logging is enabled for this project or + not. + type: boolean + type: object + type: object + multiTenant: + description: Configuration related to multi-tenant functionality. + properties: + allowTenants: + description: Whether this project can have tenants or not. + type: boolean + defaultTenantLocationRef: + oneOf: + - not: + required: + - external + required: + - name + - kind + - not: + anyOf: + - required: + - name + - required: + - namespace + - required: + - kind + required: + - external + properties: + external: + description: |- + The default cloud parent org or folder that the tenant project should be created under. The parent resource name should be in the format of "/", such as "folders/123" or "organizations/456". If the value is not set, the tenant will be created under the same organization or folder as the agent project. + + Allowed values: + * The Google Cloud resource name of a `Folder` resource (format: `folders/{{name}}`). + * The Google Cloud resource name of a Google Cloud Organization (format: `organizations/{{name}}`). + type: string + kind: + description: 'Kind of the referent. Allowed values: Folder' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + type: object + notification: + description: Configuration related to sending notifications to users. + properties: + defaultLocale: + description: Default locale used for email and SMS in IETF BCP + 47 format. + type: string + sendEmail: + description: Options for email sending. + properties: + callbackUri: + description: action url in email template. + type: string + changeEmailTemplate: + description: Email template for change email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + dnsInfo: + description: Information of custom domain DNS verification. + properties: + useCustomDomain: + description: Whether to use custom domain. + type: boolean + type: object + method: + description: 'The method used for sending an email. Possible + values: METHOD_UNSPECIFIED, DEFAULT, CUSTOM_SMTP' + type: string + resetPasswordTemplate: + description: Email template for reset password + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + revertSecondFactorAdditionTemplate: + description: Email template for reverting second factor addition + emails + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + smtp: + description: Use a custom SMTP relay + properties: + host: + description: SMTP relay host + type: string + password: + description: SMTP relay password + oneOf: + - not: + required: + - valueFrom + required: + - value + - not: + required: + - value + required: + - valueFrom + properties: + value: + description: Value of the field. Cannot be used if + 'valueFrom' is specified. + type: string + valueFrom: + description: Source for the field's value. Cannot + be used if 'value' is specified. + properties: + secretKeyRef: + description: Reference to a value with the given + key in the given Secret in the resource's namespace. + properties: + key: + description: Key that identifies the value + to be extracted. + type: string + name: + description: Name of the Secret to extract + a value from. + type: string + required: + - name + - key + type: object + type: object + type: object + port: + description: SMTP relay port + format: int64 + type: integer + securityMode: + description: 'SMTP security mode. Possible values: SECURITY_MODE_UNSPECIFIED, + SSL, START_TLS' + type: string + senderEmail: + description: Sender email for the SMTP relay + type: string + username: + description: SMTP relay username + type: string + type: object + verifyEmailTemplate: + description: Email template for verify email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + type: object + sendSms: + description: Options for SMS sending. + properties: + useDeviceLocale: + description: Whether to use the accept_language header for + SMS. + type: boolean + type: object + type: object + projectRef: + description: The Project that this resource belongs to. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + The project of the resource + + Allowed value: The Google Cloud resource name of a `Project` resource (format: `projects/{{name}}`). + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + quota: + description: Configuration related to quotas. + properties: + signUpQuotaConfig: + description: Quota for the Signup endpoint, if overwritten. Signup + quota is measured in sign ups per project per hour per IP. + properties: + quota: + description: Corresponds to the 'refill_token_count' field + in QuotaServer config + format: int64 + type: integer + quotaDuration: + description: How long this quota will be active for + type: string + startTime: + description: When this quota will take affect + format: date-time + type: string + type: object + type: object + signIn: + description: Configuration related to local sign in methods. + properties: + allowDuplicateEmails: + description: Whether to allow more than one account to have the + same email. + type: boolean + anonymous: + description: Configuration options related to authenticating an + anonymous user. + properties: + enabled: + description: Whether anonymous user auth is enabled for the + project or not. + type: boolean + type: object + email: + description: Configuration options related to authenticating a + user by their email address. + properties: + enabled: + description: Whether email auth is enabled for the project + or not. + type: boolean + passwordRequired: + description: Whether a password is required for email auth + or not. If true, both an email and password must be provided + to sign in. If false, a user may sign in via either email/password + or email link. + type: boolean + type: object + phoneNumber: + description: Configuration options related to authenticated a + user by their phone number. + properties: + enabled: + description: Whether phone number auth is enabled for the + project or not. + type: boolean + testPhoneNumbers: + additionalProperties: + type: string + description: A map of that can be used for phone auth testing. + type: object + type: object + type: object + required: + - projectRef + type: object + status: + properties: + client: + properties: + apiKey: + description: Output only. API key that can be used when making + requests for this project. + type: string + firebaseSubdomain: + description: Output only. Firebase subdomain. + type: string + type: object + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + notification: + properties: + sendEmail: + properties: + changeEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + dnsInfo: + properties: + customDomain: + description: Output only. The applied verified custom + domain. + type: string + customDomainState: + description: 'Output only. The current verification state + of the custom domain. The custom domain will only be + used once the domain verification is successful. Possible + values: VERIFICATION_STATE_UNSPECIFIED, NOT_STARTED, + IN_PROGRESS, FAILED, SUCCEEDED' + type: string + domainVerificationRequestTime: + description: Output only. The timestamp of initial request + for the current domain verification. + format: date-time + type: string + pendingCustomDomain: + description: Output only. The custom domain that's to + be verified. + type: string + type: object + resetPasswordTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + revertSecondFactorAdditionTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + verifyEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + type: object + sendSms: + properties: + smsTemplate: + description: Output only. The template to use when sending + an SMS. + properties: + content: + description: 'Output only. The SMS''s content. Can contain + the following placeholders which will be replaced with + the appropriate values: %APP_NAME% - For Android or + iOS apps, the app''s display name. For web apps, the + domain hosting the application. %LOGIN_CODE% - The OOB + code being sent in the SMS.' + type: string + type: object + type: object + type: object + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + signIn: + properties: + email: + properties: + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, + MD5, HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, + SHA512, STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation + algorithms. See https://tools.ietf.org/html/rfc7914 + for explanation of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation + algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be + inserted between the salt and plain text password in + base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, MD5, + HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, SHA512, + STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation algorithms. + See https://tools.ietf.org/html/rfc7914 for explanation + of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be inserted + between the salt and plain text password in base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + subtype: + description: 'Output only. The subtype of this config. Possible values: + SUBTYPE_UNSPECIFIED, IDENTITY_PLATFORM, FIREBASE_AUTH' + type: string + type: object + required: + - spec + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] +--- +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37942,7 +38624,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38158,7 +38840,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38311,7 +38993,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38503,7 +39185,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38629,7 +39311,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38912,7 +39594,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39187,7 +39869,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39607,7 +40289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -39979,7 +40661,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40281,7 +40963,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -40516,7 +41198,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41319,7 +42001,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -43102,7 +43784,6 @@ spec: description: The informational elements that are arranged into the columns row-first. items: - description: The informational widget contained in the tile. properties: blank: description: A blank space. @@ -46281,8 +46962,6 @@ spec: description: The display widgets arranged horizontally in this row. items: - description: The informational widget contained in the - tile. properties: blank: description: A blank space. @@ -48040,7 +48719,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -48231,7 +48910,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -48522,7 +49201,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -48815,7 +49494,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49385,7 +50064,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49544,7 +50223,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49920,7 +50599,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50102,7 +50781,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50441,7 +51120,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50699,7 +51378,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50928,7 +51607,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51172,7 +51851,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51493,7 +52172,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51706,7 +52385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52186,7 +52865,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52941,7 +53620,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53123,7 +53802,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53467,7 +54146,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54236,7 +54915,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55234,7 +55913,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55730,7 +56409,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56708,7 +57387,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57124,7 +57803,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57349,7 +58028,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57706,7 +58385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57883,7 +58562,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -58119,7 +58798,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58530,7 +59209,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58708,7 +59387,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58989,7 +59668,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59887,7 +60566,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60140,7 +60819,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60340,7 +61019,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60518,7 +61197,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60659,7 +61338,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60858,7 +61537,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61052,7 +61731,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61192,7 +61871,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61356,7 +62035,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61927,7 +62606,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62103,7 +62782,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62299,7 +62978,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62469,7 +63148,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62802,7 +63481,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62988,7 +63667,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63191,7 +63870,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63743,7 +64422,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml b/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml index 78a4f4ecfb..ffd63e41d6 100644 --- a/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml +++ b/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: Namespace metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-system @@ -25,7 +25,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -35,7 +35,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-resource-stats-recorder @@ -45,7 +45,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-manager @@ -55,7 +55,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-cnrm-system-role @@ -76,7 +76,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-cnrm-system-role @@ -97,7 +97,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -170,7 +170,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role @@ -220,7 +220,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-cluster-role @@ -278,7 +278,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-ns-role @@ -303,7 +303,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-role @@ -333,7 +333,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -401,7 +401,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role @@ -464,7 +464,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role-binding @@ -482,7 +482,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role-binding @@ -500,7 +500,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-admin-binding @@ -520,7 +520,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-binding @@ -537,7 +537,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-binding @@ -554,7 +554,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-binding @@ -571,7 +571,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -588,7 +588,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -609,7 +609,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -627,7 +627,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -640,8 +640,8 @@ spec: - /configconnector/recorder env: - name: CONFIG_CONNECTOR_VERSION - value: 1.76.0 - image: gcr.io/cnrm-eap/recorder:eb26258 + value: 1.77.0 + image: gcr.io/cnrm-eap/recorder:32441bd imagePullPolicy: Always name: recorder ports: @@ -673,7 +673,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -688,7 +688,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -701,7 +701,7 @@ spec: valueFrom: fieldRef: fieldPath: metadata.namespace - image: gcr.io/cnrm-eap/webhook:eb26258 + image: gcr.io/cnrm-eap/webhook:32441bd imagePullPolicy: Always name: webhook ports: @@ -729,7 +729,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -744,7 +744,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -752,7 +752,7 @@ spec: containers: - command: - /configconnector/deletiondefender - image: gcr.io/cnrm-eap/deletiondefender:eb26258 + image: gcr.io/cnrm-eap/deletiondefender:32441bd imagePullPolicy: Always name: deletiondefender ports: @@ -780,7 +780,7 @@ apiVersion: autoscaling/v2beta2 kind: HorizontalPodAutoscaler metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook diff --git a/install-bundles/install-bundle-namespaced/crds.yaml b/install-bundles/install-bundle-namespaced/crds.yaml index 6a58e1b691..227fc5456a 100644 --- a/install-bundles/install-bundle-namespaced/crds.yaml +++ b/install-bundles/install-bundle-namespaced/crds.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -402,7 +402,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -532,7 +532,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1724,7 +1724,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1904,7 +1904,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2253,7 +2253,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3088,7 +3088,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3529,7 +3529,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3706,7 +3706,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3911,7 +3911,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4108,7 +4108,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4270,7 +4270,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -4723,7 +4723,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -4990,7 +4990,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5063,9 +5063,6 @@ spec: type: array clusterAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5176,9 +5173,6 @@ spec: type: string istioServiceIdentityAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5229,9 +5223,6 @@ spec: type: object kubernetesNamespaceAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5281,9 +5272,6 @@ spec: type: object kubernetesServiceAccountAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5427,7 +5415,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -6465,7 +6453,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -6894,7 +6882,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7088,7 +7076,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7332,7 +7320,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7870,7 +7858,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8123,7 +8111,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8349,7 +8337,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -9408,7 +9396,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10025,7 +10013,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10171,7 +10159,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10391,7 +10379,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10581,7 +10569,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10870,7 +10858,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11250,7 +11238,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11884,7 +11872,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12348,7 +12336,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12509,7 +12497,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12670,7 +12658,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12949,7 +12937,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -13272,17 +13260,15 @@ spec: groups, proactive redistribution is disabled.' type: string maxSurge: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: The maximum number of instances that can be created + above the specified `targetSize` during the update process. + This value can be either a fixed number or, if the group has + 10 or more instances, a percentage. If you set a percentage, + the number of instances is rounded if necessary. The default + value for `maxSurge` is a fixed value equal to the number of + zones in which the managed instance group operates. At least + one of either `maxSurge` or `maxUnavailable` must be greater + than 0. Learn more about [`maxSurge`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_surge). properties: fixed: description: Specifies a fixed number of VM instances. This @@ -13296,17 +13282,21 @@ spec: type: integer type: object maxUnavailable: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: 'The maximum number of instances that can be unavailable + during the update process. An instance is considered available + if all of the following conditions are satisfied: - The instance''s + [status](/compute/docs/instances/checking-instance-status) is + `RUNNING`. - If there is a [health check](/compute/docs/instance-groups/autohealing-instances-in-migs) + on the instance group, the instance''s health check status must + be `HEALTHY` at least once. If there is no health check on the + group, then the instance only needs to have a status of `RUNNING` + to be considered available. This value can be either a fixed + number or, if the group has 10 or more instances, a percentage. + If you set a percentage, the number of instances is rounded + if necessary. The default value for `maxUnavailable` is a fixed + value equal to the number of zones in which the managed instance + group operates. At least one of either `maxSurge` or `maxUnavailable` + must be greater than 0. Learn more about [`maxUnavailable`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_unavailable).' properties: fixed: description: Specifies a fixed number of VM instances. This @@ -13691,7 +13681,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13894,7 +13884,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -14783,7 +14773,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15519,7 +15509,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15845,7 +15835,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16053,7 +16043,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16248,7 +16238,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16398,7 +16388,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16607,7 +16597,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16788,7 +16778,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -17185,7 +17175,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17303,7 +17293,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17517,7 +17507,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17815,7 +17805,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18025,7 +18015,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18356,7 +18346,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18662,7 +18652,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18886,7 +18876,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19165,7 +19155,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19468,7 +19458,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -19814,7 +19804,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19920,7 +19910,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20059,7 +20049,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20438,7 +20428,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20653,7 +20643,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20816,7 +20806,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21104,7 +21094,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21282,7 +21272,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21452,7 +21442,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21696,7 +21686,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21892,7 +21882,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22118,7 +22108,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22346,7 +22336,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22513,7 +22503,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22674,7 +22664,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25385,7 +25375,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25584,7 +25574,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25956,7 +25946,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -26197,7 +26187,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -26787,7 +26777,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28047,7 +28037,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28596,7 +28586,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28722,7 +28712,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -29008,7 +28998,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -29286,7 +29276,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -29581,7 +29571,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30768,7 +30758,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -32633,7 +32623,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -32961,7 +32951,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -33157,7 +33147,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -33313,7 +33303,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -33526,7 +33516,7 @@ spec: properties: external: description: |- - Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts?hl=en#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. + Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. Allowed value: The `email` field of an `IAMServiceAccount` resource. type: string @@ -33667,7 +33657,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -33888,7 +33878,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34214,7 +34204,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34368,7 +34358,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34581,7 +34571,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34719,7 +34709,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35059,7 +35049,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35299,7 +35289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35664,7 +35654,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35825,7 +35815,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35965,7 +35955,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36262,7 +36252,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36490,7 +36480,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36704,7 +36694,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36883,7 +36873,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -37020,7 +37010,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37315,7 +37305,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37482,7 +37472,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37606,7 +37596,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37759,7 +37749,699 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: identityplatformconfigs.identityplatform.cnrm.cloud.google.com +spec: + group: identityplatform.cnrm.cloud.google.com + names: + categories: + - gcp + kind: IdentityPlatformConfig + plural: identityplatformconfigs + shortNames: + - gcpidentityplatformconfig + - gcpidentityplatformconfigs + singular: identityplatformconfig + preserveUnknownFields: false + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + properties: + authorizedDomains: + description: List of domains authorized for OAuth redirects + items: + type: string + type: array + blockingFunctions: + description: Configuration related to blocking functions. + properties: + triggers: + additionalProperties: + properties: + functionUriRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + HTTP URI trigger for the Cloud Function. + + Allowed value: The `httpsTrigger.url` field of a `CloudFunctionsFunction` resource. + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + updateTime: + description: When the trigger was changed. + format: date-time + type: string + type: object + description: 'Map of Trigger to event type. Key should be one + of the supported event types: "beforeCreate", "beforeSignIn"' + type: object + type: object + client: + description: Options related to how clients making requests on behalf + of a project should be configured. + properties: + permissions: + description: Configuration related to restricting a user's ability + to affect their account. + properties: + disabledUserDeletion: + description: When true, end users cannot delete their account + on the associated project through any of our API methods + type: boolean + disabledUserSignup: + description: When true, end users cannot sign up for a new + account on the associated project through any of our API + methods + type: boolean + type: object + type: object + mfa: + description: Configuration for this project's multi-factor authentication, + including whether it is active and what factors can be used for + the second factor + properties: + state: + description: 'Whether MultiFactor Authentication has been enabled + for this project. Possible values: STATE_UNSPECIFIED, DISABLED, + ENABLED, MANDATORY' + type: string + type: object + monitoring: + description: Configuration related to monitoring project activity. + properties: + requestLogging: + description: Configuration for logging requests made to this project + to Stackdriver Logging + properties: + enabled: + description: Whether logging is enabled for this project or + not. + type: boolean + type: object + type: object + multiTenant: + description: Configuration related to multi-tenant functionality. + properties: + allowTenants: + description: Whether this project can have tenants or not. + type: boolean + defaultTenantLocationRef: + oneOf: + - not: + required: + - external + required: + - name + - kind + - not: + anyOf: + - required: + - name + - required: + - namespace + - required: + - kind + required: + - external + properties: + external: + description: |- + The default cloud parent org or folder that the tenant project should be created under. The parent resource name should be in the format of "/", such as "folders/123" or "organizations/456". If the value is not set, the tenant will be created under the same organization or folder as the agent project. + + Allowed values: + * The Google Cloud resource name of a `Folder` resource (format: `folders/{{name}}`). + * The Google Cloud resource name of a Google Cloud Organization (format: `organizations/{{name}}`). + type: string + kind: + description: 'Kind of the referent. Allowed values: Folder' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + type: object + notification: + description: Configuration related to sending notifications to users. + properties: + defaultLocale: + description: Default locale used for email and SMS in IETF BCP + 47 format. + type: string + sendEmail: + description: Options for email sending. + properties: + callbackUri: + description: action url in email template. + type: string + changeEmailTemplate: + description: Email template for change email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + dnsInfo: + description: Information of custom domain DNS verification. + properties: + useCustomDomain: + description: Whether to use custom domain. + type: boolean + type: object + method: + description: 'The method used for sending an email. Possible + values: METHOD_UNSPECIFIED, DEFAULT, CUSTOM_SMTP' + type: string + resetPasswordTemplate: + description: Email template for reset password + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + revertSecondFactorAdditionTemplate: + description: Email template for reverting second factor addition + emails + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + smtp: + description: Use a custom SMTP relay + properties: + host: + description: SMTP relay host + type: string + password: + description: SMTP relay password + oneOf: + - not: + required: + - valueFrom + required: + - value + - not: + required: + - value + required: + - valueFrom + properties: + value: + description: Value of the field. Cannot be used if + 'valueFrom' is specified. + type: string + valueFrom: + description: Source for the field's value. Cannot + be used if 'value' is specified. + properties: + secretKeyRef: + description: Reference to a value with the given + key in the given Secret in the resource's namespace. + properties: + key: + description: Key that identifies the value + to be extracted. + type: string + name: + description: Name of the Secret to extract + a value from. + type: string + required: + - name + - key + type: object + type: object + type: object + port: + description: SMTP relay port + format: int64 + type: integer + securityMode: + description: 'SMTP security mode. Possible values: SECURITY_MODE_UNSPECIFIED, + SSL, START_TLS' + type: string + senderEmail: + description: Sender email for the SMTP relay + type: string + username: + description: SMTP relay username + type: string + type: object + verifyEmailTemplate: + description: Email template for verify email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + type: object + sendSms: + description: Options for SMS sending. + properties: + useDeviceLocale: + description: Whether to use the accept_language header for + SMS. + type: boolean + type: object + type: object + projectRef: + description: The Project that this resource belongs to. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + The project of the resource + + Allowed value: The Google Cloud resource name of a `Project` resource (format: `projects/{{name}}`). + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + quota: + description: Configuration related to quotas. + properties: + signUpQuotaConfig: + description: Quota for the Signup endpoint, if overwritten. Signup + quota is measured in sign ups per project per hour per IP. + properties: + quota: + description: Corresponds to the 'refill_token_count' field + in QuotaServer config + format: int64 + type: integer + quotaDuration: + description: How long this quota will be active for + type: string + startTime: + description: When this quota will take affect + format: date-time + type: string + type: object + type: object + signIn: + description: Configuration related to local sign in methods. + properties: + allowDuplicateEmails: + description: Whether to allow more than one account to have the + same email. + type: boolean + anonymous: + description: Configuration options related to authenticating an + anonymous user. + properties: + enabled: + description: Whether anonymous user auth is enabled for the + project or not. + type: boolean + type: object + email: + description: Configuration options related to authenticating a + user by their email address. + properties: + enabled: + description: Whether email auth is enabled for the project + or not. + type: boolean + passwordRequired: + description: Whether a password is required for email auth + or not. If true, both an email and password must be provided + to sign in. If false, a user may sign in via either email/password + or email link. + type: boolean + type: object + phoneNumber: + description: Configuration options related to authenticated a + user by their phone number. + properties: + enabled: + description: Whether phone number auth is enabled for the + project or not. + type: boolean + testPhoneNumbers: + additionalProperties: + type: string + description: A map of that can be used for phone auth testing. + type: object + type: object + type: object + required: + - projectRef + type: object + status: + properties: + client: + properties: + apiKey: + description: Output only. API key that can be used when making + requests for this project. + type: string + firebaseSubdomain: + description: Output only. Firebase subdomain. + type: string + type: object + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + notification: + properties: + sendEmail: + properties: + changeEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + dnsInfo: + properties: + customDomain: + description: Output only. The applied verified custom + domain. + type: string + customDomainState: + description: 'Output only. The current verification state + of the custom domain. The custom domain will only be + used once the domain verification is successful. Possible + values: VERIFICATION_STATE_UNSPECIFIED, NOT_STARTED, + IN_PROGRESS, FAILED, SUCCEEDED' + type: string + domainVerificationRequestTime: + description: Output only. The timestamp of initial request + for the current domain verification. + format: date-time + type: string + pendingCustomDomain: + description: Output only. The custom domain that's to + be verified. + type: string + type: object + resetPasswordTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + revertSecondFactorAdditionTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + verifyEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + type: object + sendSms: + properties: + smsTemplate: + description: Output only. The template to use when sending + an SMS. + properties: + content: + description: 'Output only. The SMS''s content. Can contain + the following placeholders which will be replaced with + the appropriate values: %APP_NAME% - For Android or + iOS apps, the app''s display name. For web apps, the + domain hosting the application. %LOGIN_CODE% - The OOB + code being sent in the SMS.' + type: string + type: object + type: object + type: object + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + signIn: + properties: + email: + properties: + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, + MD5, HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, + SHA512, STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation + algorithms. See https://tools.ietf.org/html/rfc7914 + for explanation of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation + algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be + inserted between the salt and plain text password in + base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, MD5, + HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, SHA512, + STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation algorithms. + See https://tools.ietf.org/html/rfc7914 for explanation + of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be inserted + between the salt and plain text password in base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + subtype: + description: 'Output only. The subtype of this config. Possible values: + SUBTYPE_UNSPECIFIED, IDENTITY_PLATFORM, FIREBASE_AUTH' + type: string + type: object + required: + - spec + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] +--- +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37942,7 +38624,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38158,7 +38840,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38311,7 +38993,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38503,7 +39185,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38629,7 +39311,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38912,7 +39594,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39187,7 +39869,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39607,7 +40289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -39979,7 +40661,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40281,7 +40963,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -40516,7 +41198,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41319,7 +42001,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -43102,7 +43784,6 @@ spec: description: The informational elements that are arranged into the columns row-first. items: - description: The informational widget contained in the tile. properties: blank: description: A blank space. @@ -46281,8 +46962,6 @@ spec: description: The display widgets arranged horizontally in this row. items: - description: The informational widget contained in the - tile. properties: blank: description: A blank space. @@ -48040,7 +48719,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -48231,7 +48910,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -48522,7 +49201,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -48815,7 +49494,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49385,7 +50064,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49544,7 +50223,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49920,7 +50599,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50102,7 +50781,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50441,7 +51120,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50699,7 +51378,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50928,7 +51607,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51172,7 +51851,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51493,7 +52172,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51706,7 +52385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52186,7 +52865,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52941,7 +53620,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53123,7 +53802,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53467,7 +54146,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54236,7 +54915,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55234,7 +55913,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55730,7 +56409,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56708,7 +57387,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57124,7 +57803,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57349,7 +58028,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57706,7 +58385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57883,7 +58562,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -58119,7 +58798,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58530,7 +59209,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58708,7 +59387,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58989,7 +59668,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59887,7 +60566,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60140,7 +60819,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60340,7 +61019,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60518,7 +61197,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60659,7 +61338,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60858,7 +61537,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61052,7 +61731,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61192,7 +61871,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61356,7 +62035,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61927,7 +62606,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62103,7 +62782,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62299,7 +62978,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62469,7 +63148,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62802,7 +63481,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62988,7 +63667,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63191,7 +63870,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63743,7 +64422,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/install-bundles/install-bundle-namespaced/per-namespace-components.yaml b/install-bundles/install-bundle-namespaced/per-namespace-components.yaml index 75781a5ee4..de118b2d68 100644 --- a/install-bundles/install-bundle-namespaced/per-namespace-components.yaml +++ b/install-bundles/install-bundle-namespaced/per-namespace-components.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 iam.gke.io/gcp-service-account: cnrm-system-${NAMESPACE?}@${PROJECT_ID?}.iam.gserviceaccount.com labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} @@ -28,7 +28,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -47,7 +47,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -66,7 +66,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -85,7 +85,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -103,7 +103,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -127,7 +127,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} @@ -144,7 +144,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} @@ -156,7 +156,7 @@ spec: - --prometheus-scrape-endpoint=:8888 command: - /configconnector/manager - image: gcr.io/cnrm-eap/controller:eb26258 + image: gcr.io/cnrm-eap/controller:32441bd imagePullPolicy: Always name: manager ports: diff --git a/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml b/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml index 10e5fe03f6..e225320954 100644 --- a/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml +++ b/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: Namespace metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-system @@ -25,7 +25,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 iam.gke.io/gcp-service-account: cnrm-system@${PROJECT_ID?}.iam.gserviceaccount.com labels: cnrm.cloud.google.com/system: "true" @@ -36,7 +36,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -46,7 +46,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-resource-stats-recorder @@ -56,7 +56,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-manager @@ -66,7 +66,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-cnrm-system-role @@ -87,7 +87,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-cnrm-system-role @@ -108,7 +108,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -181,7 +181,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role @@ -231,7 +231,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-cluster-role @@ -289,7 +289,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-ns-role @@ -314,7 +314,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-role @@ -344,7 +344,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -412,7 +412,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role @@ -475,7 +475,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role-binding @@ -493,7 +493,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role-binding @@ -511,7 +511,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-admin-binding @@ -534,7 +534,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-binding @@ -551,7 +551,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-binding @@ -568,7 +568,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-watcher-binding @@ -585,7 +585,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-binding @@ -602,7 +602,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-binding @@ -619,7 +619,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -636,7 +636,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -658,7 +658,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -679,7 +679,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -697,7 +697,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -710,8 +710,8 @@ spec: - /configconnector/recorder env: - name: CONFIG_CONNECTOR_VERSION - value: 1.76.0 - image: gcr.io/cnrm-eap/recorder:eb26258 + value: 1.77.0 + image: gcr.io/cnrm-eap/recorder:32441bd imagePullPolicy: Always name: recorder ports: @@ -743,7 +743,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -758,7 +758,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -771,7 +771,7 @@ spec: valueFrom: fieldRef: fieldPath: metadata.namespace - image: gcr.io/cnrm-eap/webhook:eb26258 + image: gcr.io/cnrm-eap/webhook:32441bd imagePullPolicy: Always name: webhook ports: @@ -799,7 +799,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -814,7 +814,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -824,7 +824,7 @@ spec: - --prometheus-scrape-endpoint=:8888 command: - /configconnector/manager - image: gcr.io/cnrm-eap/controller:eb26258 + image: gcr.io/cnrm-eap/controller:32441bd imagePullPolicy: Always name: manager ports: @@ -852,7 +852,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -867,7 +867,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -875,7 +875,7 @@ spec: containers: - command: - /configconnector/deletiondefender - image: gcr.io/cnrm-eap/deletiondefender:eb26258 + image: gcr.io/cnrm-eap/deletiondefender:32441bd imagePullPolicy: Always name: deletiondefender ports: @@ -903,7 +903,7 @@ apiVersion: autoscaling/v2beta2 kind: HorizontalPodAutoscaler metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook diff --git a/install-bundles/install-bundle-workload-identity/crds.yaml b/install-bundles/install-bundle-workload-identity/crds.yaml index 6a58e1b691..227fc5456a 100644 --- a/install-bundles/install-bundle-workload-identity/crds.yaml +++ b/install-bundles/install-bundle-workload-identity/crds.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -402,7 +402,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -532,7 +532,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1724,7 +1724,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1904,7 +1904,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2253,7 +2253,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3088,7 +3088,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3529,7 +3529,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3706,7 +3706,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3911,7 +3911,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4108,7 +4108,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4270,7 +4270,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -4723,7 +4723,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -4990,7 +4990,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5063,9 +5063,6 @@ spec: type: array clusterAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5176,9 +5173,6 @@ spec: type: string istioServiceIdentityAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5229,9 +5223,6 @@ spec: type: object kubernetesNamespaceAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5281,9 +5272,6 @@ spec: type: object kubernetesServiceAccountAdmissionRules: additionalProperties: - description: Required. Default admission rule for a cluster without - a per-cluster, per-kubernetes-service-account, or per-istio-service-identity - admission rule. properties: enforcementMode: description: 'Required. The action when a pod creation is denied @@ -5427,7 +5415,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -6465,7 +6453,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -6894,7 +6882,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7088,7 +7076,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7332,7 +7320,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7870,7 +7858,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8123,7 +8111,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8349,7 +8337,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -9408,7 +9396,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10025,7 +10013,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10171,7 +10159,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10391,7 +10379,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10581,7 +10569,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -10870,7 +10858,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11250,7 +11238,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11884,7 +11872,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12348,7 +12336,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12509,7 +12497,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12670,7 +12658,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12949,7 +12937,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -13272,17 +13260,15 @@ spec: groups, proactive redistribution is disabled.' type: string maxSurge: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: The maximum number of instances that can be created + above the specified `targetSize` during the update process. + This value can be either a fixed number or, if the group has + 10 or more instances, a percentage. If you set a percentage, + the number of instances is rounded if necessary. The default + value for `maxSurge` is a fixed value equal to the number of + zones in which the managed instance group operates. At least + one of either `maxSurge` or `maxUnavailable` must be greater + than 0. Learn more about [`maxSurge`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_surge). properties: fixed: description: Specifies a fixed number of VM instances. This @@ -13296,17 +13282,21 @@ spec: type: integer type: object maxUnavailable: - description: 'Specifies the intended number of instances to be - created from the `instanceTemplate`. The final number of instances - created from the template will be equal to: - If expressed as - a fixed number, the minimum of either `targetSize.fixed` or - `instanceGroupManager.targetSize` is used. - if expressed as - a `percent`, the `targetSize` would be `(targetSize.percent/100 - * InstanceGroupManager.targetSize)` If there is a remainder, - the number is rounded. If unset, this version will update any - remaining instances not updated by another `version`. Read [Starting - a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) - for more information.' + description: 'The maximum number of instances that can be unavailable + during the update process. An instance is considered available + if all of the following conditions are satisfied: - The instance''s + [status](/compute/docs/instances/checking-instance-status) is + `RUNNING`. - If there is a [health check](/compute/docs/instance-groups/autohealing-instances-in-migs) + on the instance group, the instance''s health check status must + be `HEALTHY` at least once. If there is no health check on the + group, then the instance only needs to have a status of `RUNNING` + to be considered available. This value can be either a fixed + number or, if the group has 10 or more instances, a percentage. + If you set a percentage, the number of instances is rounded + if necessary. The default value for `maxUnavailable` is a fixed + value equal to the number of zones in which the managed instance + group operates. At least one of either `maxSurge` or `maxUnavailable` + must be greater than 0. Learn more about [`maxUnavailable`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_unavailable).' properties: fixed: description: Specifies a fixed number of VM instances. This @@ -13691,7 +13681,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13894,7 +13884,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -14783,7 +14773,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15519,7 +15509,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15845,7 +15835,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16053,7 +16043,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16248,7 +16238,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16398,7 +16388,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16607,7 +16597,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16788,7 +16778,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -17185,7 +17175,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17303,7 +17293,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17517,7 +17507,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17815,7 +17805,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18025,7 +18015,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18356,7 +18346,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18662,7 +18652,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18886,7 +18876,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19165,7 +19155,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19468,7 +19458,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -19814,7 +19804,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19920,7 +19910,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20059,7 +20049,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20438,7 +20428,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20653,7 +20643,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20816,7 +20806,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21104,7 +21094,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21282,7 +21272,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21452,7 +21442,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21696,7 +21686,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21892,7 +21882,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22118,7 +22108,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22346,7 +22336,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22513,7 +22503,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22674,7 +22664,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25385,7 +25375,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25584,7 +25574,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -25956,7 +25946,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -26197,7 +26187,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -26787,7 +26777,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28047,7 +28037,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28596,7 +28586,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -28722,7 +28712,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -29008,7 +28998,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -29286,7 +29276,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -29581,7 +29571,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30768,7 +30758,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -32633,7 +32623,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -32961,7 +32951,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -33157,7 +33147,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -33313,7 +33303,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -33526,7 +33516,7 @@ spec: properties: external: description: |- - Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts?hl=en#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. + Optional. The IAM service account email associated with the trigger. The service account represents the identity of the trigger. The principal who calls this API must have `iam.serviceAccounts.actAs` permission in the service account. See https://cloud.google.com/iam/docs/understanding-service-accounts#sa_common for more information. For Cloud Run destinations, this service account is used to generate identity tokens when invoking the service. See https://cloud.google.com/run/docs/triggering/pubsub-push#create-service-account for information on how to invoke authenticated Cloud Run services. In order to create Audit Log triggers, the service account should also have `roles/eventarc.eventReceiver` IAM role. Allowed value: The `email` field of an `IAMServiceAccount` resource. type: string @@ -33667,7 +33657,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -33888,7 +33878,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34214,7 +34204,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34368,7 +34358,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34581,7 +34571,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34719,7 +34709,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35059,7 +35049,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35299,7 +35289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35664,7 +35654,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35825,7 +35815,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35965,7 +35955,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36262,7 +36252,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36490,7 +36480,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36704,7 +36694,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36883,7 +36873,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -37020,7 +37010,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37315,7 +37305,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37482,7 +37472,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37606,7 +37596,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37759,7 +37749,699 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: identityplatformconfigs.identityplatform.cnrm.cloud.google.com +spec: + group: identityplatform.cnrm.cloud.google.com + names: + categories: + - gcp + kind: IdentityPlatformConfig + plural: identityplatformconfigs + shortNames: + - gcpidentityplatformconfig + - gcpidentityplatformconfigs + singular: identityplatformconfig + preserveUnknownFields: false + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + properties: + authorizedDomains: + description: List of domains authorized for OAuth redirects + items: + type: string + type: array + blockingFunctions: + description: Configuration related to blocking functions. + properties: + triggers: + additionalProperties: + properties: + functionUriRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + HTTP URI trigger for the Cloud Function. + + Allowed value: The `httpsTrigger.url` field of a `CloudFunctionsFunction` resource. + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + updateTime: + description: When the trigger was changed. + format: date-time + type: string + type: object + description: 'Map of Trigger to event type. Key should be one + of the supported event types: "beforeCreate", "beforeSignIn"' + type: object + type: object + client: + description: Options related to how clients making requests on behalf + of a project should be configured. + properties: + permissions: + description: Configuration related to restricting a user's ability + to affect their account. + properties: + disabledUserDeletion: + description: When true, end users cannot delete their account + on the associated project through any of our API methods + type: boolean + disabledUserSignup: + description: When true, end users cannot sign up for a new + account on the associated project through any of our API + methods + type: boolean + type: object + type: object + mfa: + description: Configuration for this project's multi-factor authentication, + including whether it is active and what factors can be used for + the second factor + properties: + state: + description: 'Whether MultiFactor Authentication has been enabled + for this project. Possible values: STATE_UNSPECIFIED, DISABLED, + ENABLED, MANDATORY' + type: string + type: object + monitoring: + description: Configuration related to monitoring project activity. + properties: + requestLogging: + description: Configuration for logging requests made to this project + to Stackdriver Logging + properties: + enabled: + description: Whether logging is enabled for this project or + not. + type: boolean + type: object + type: object + multiTenant: + description: Configuration related to multi-tenant functionality. + properties: + allowTenants: + description: Whether this project can have tenants or not. + type: boolean + defaultTenantLocationRef: + oneOf: + - not: + required: + - external + required: + - name + - kind + - not: + anyOf: + - required: + - name + - required: + - namespace + - required: + - kind + required: + - external + properties: + external: + description: |- + The default cloud parent org or folder that the tenant project should be created under. The parent resource name should be in the format of "/", such as "folders/123" or "organizations/456". If the value is not set, the tenant will be created under the same organization or folder as the agent project. + + Allowed values: + * The Google Cloud resource name of a `Folder` resource (format: `folders/{{name}}`). + * The Google Cloud resource name of a Google Cloud Organization (format: `organizations/{{name}}`). + type: string + kind: + description: 'Kind of the referent. Allowed values: Folder' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + type: object + notification: + description: Configuration related to sending notifications to users. + properties: + defaultLocale: + description: Default locale used for email and SMS in IETF BCP + 47 format. + type: string + sendEmail: + description: Options for email sending. + properties: + callbackUri: + description: action url in email template. + type: string + changeEmailTemplate: + description: Email template for change email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + dnsInfo: + description: Information of custom domain DNS verification. + properties: + useCustomDomain: + description: Whether to use custom domain. + type: boolean + type: object + method: + description: 'The method used for sending an email. Possible + values: METHOD_UNSPECIFIED, DEFAULT, CUSTOM_SMTP' + type: string + resetPasswordTemplate: + description: Email template for reset password + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + revertSecondFactorAdditionTemplate: + description: Email template for reverting second factor addition + emails + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + smtp: + description: Use a custom SMTP relay + properties: + host: + description: SMTP relay host + type: string + password: + description: SMTP relay password + oneOf: + - not: + required: + - valueFrom + required: + - value + - not: + required: + - value + required: + - valueFrom + properties: + value: + description: Value of the field. Cannot be used if + 'valueFrom' is specified. + type: string + valueFrom: + description: Source for the field's value. Cannot + be used if 'value' is specified. + properties: + secretKeyRef: + description: Reference to a value with the given + key in the given Secret in the resource's namespace. + properties: + key: + description: Key that identifies the value + to be extracted. + type: string + name: + description: Name of the Secret to extract + a value from. + type: string + required: + - name + - key + type: object + type: object + type: object + port: + description: SMTP relay port + format: int64 + type: integer + securityMode: + description: 'SMTP security mode. Possible values: SECURITY_MODE_UNSPECIFIED, + SSL, START_TLS' + type: string + senderEmail: + description: Sender email for the SMTP relay + type: string + username: + description: SMTP relay username + type: string + type: object + verifyEmailTemplate: + description: Email template for verify email + properties: + body: + description: Email body + type: string + bodyFormat: + description: 'Email body format Possible values: BODY_FORMAT_UNSPECIFIED, + PLAIN_TEXT, HTML' + type: string + replyTo: + description: Reply-to address + type: string + senderDisplayName: + description: Sender display name + type: string + senderLocalPart: + description: Local part of From address + type: string + subject: + description: Subject of the email + type: string + type: object + type: object + sendSms: + description: Options for SMS sending. + properties: + useDeviceLocale: + description: Whether to use the accept_language header for + SMS. + type: boolean + type: object + type: object + projectRef: + description: The Project that this resource belongs to. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + The project of the resource + + Allowed value: The Google Cloud resource name of a `Project` resource (format: `projects/{{name}}`). + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + quota: + description: Configuration related to quotas. + properties: + signUpQuotaConfig: + description: Quota for the Signup endpoint, if overwritten. Signup + quota is measured in sign ups per project per hour per IP. + properties: + quota: + description: Corresponds to the 'refill_token_count' field + in QuotaServer config + format: int64 + type: integer + quotaDuration: + description: How long this quota will be active for + type: string + startTime: + description: When this quota will take affect + format: date-time + type: string + type: object + type: object + signIn: + description: Configuration related to local sign in methods. + properties: + allowDuplicateEmails: + description: Whether to allow more than one account to have the + same email. + type: boolean + anonymous: + description: Configuration options related to authenticating an + anonymous user. + properties: + enabled: + description: Whether anonymous user auth is enabled for the + project or not. + type: boolean + type: object + email: + description: Configuration options related to authenticating a + user by their email address. + properties: + enabled: + description: Whether email auth is enabled for the project + or not. + type: boolean + passwordRequired: + description: Whether a password is required for email auth + or not. If true, both an email and password must be provided + to sign in. If false, a user may sign in via either email/password + or email link. + type: boolean + type: object + phoneNumber: + description: Configuration options related to authenticated a + user by their phone number. + properties: + enabled: + description: Whether phone number auth is enabled for the + project or not. + type: boolean + testPhoneNumbers: + additionalProperties: + type: string + description: A map of that can be used for phone auth testing. + type: object + type: object + type: object + required: + - projectRef + type: object + status: + properties: + client: + properties: + apiKey: + description: Output only. API key that can be used when making + requests for this project. + type: string + firebaseSubdomain: + description: Output only. Firebase subdomain. + type: string + type: object + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + notification: + properties: + sendEmail: + properties: + changeEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + dnsInfo: + properties: + customDomain: + description: Output only. The applied verified custom + domain. + type: string + customDomainState: + description: 'Output only. The current verification state + of the custom domain. The custom domain will only be + used once the domain verification is successful. Possible + values: VERIFICATION_STATE_UNSPECIFIED, NOT_STARTED, + IN_PROGRESS, FAILED, SUCCEEDED' + type: string + domainVerificationRequestTime: + description: Output only. The timestamp of initial request + for the current domain verification. + format: date-time + type: string + pendingCustomDomain: + description: Output only. The custom domain that's to + be verified. + type: string + type: object + resetPasswordTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + revertSecondFactorAdditionTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + verifyEmailTemplate: + properties: + customized: + description: Output only. Whether the body or subject + of the email is customized. + type: boolean + type: object + type: object + sendSms: + properties: + smsTemplate: + description: Output only. The template to use when sending + an SMS. + properties: + content: + description: 'Output only. The SMS''s content. Can contain + the following placeholders which will be replaced with + the appropriate values: %APP_NAME% - For Android or + iOS apps, the app''s display name. For web apps, the + domain hosting the application. %LOGIN_CODE% - The OOB + code being sent in the SMS.' + type: string + type: object + type: object + type: object + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + signIn: + properties: + email: + properties: + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, + MD5, HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, + SHA512, STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation + algorithms. See https://tools.ietf.org/html/rfc7914 + for explanation of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation + algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be + inserted between the salt and plain text password in + base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + hashConfig: + description: Output only. Hash config information. + properties: + algorithm: + description: 'Output only. Different password hash algorithms + used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, + HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, MD5, + HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, SHA512, + STANDARD_SCRYPT' + type: string + memoryCost: + description: Output only. Memory cost for hash calculation. + Used by scrypt and other similar password derivation algorithms. + See https://tools.ietf.org/html/rfc7914 for explanation + of field. + format: int64 + type: integer + rounds: + description: Output only. How many rounds for hash calculation. + Used by scrypt and other similar password derivation algorithms. + format: int64 + type: integer + saltSeparator: + description: Output only. Non-printable character to be inserted + between the salt and plain text password in base64. + type: string + signerKey: + description: Output only. Signer key in base64. + type: string + type: object + type: object + subtype: + description: 'Output only. The subtype of this config. Possible values: + SUBTYPE_UNSPECIFIED, IDENTITY_PLATFORM, FIREBASE_AUTH' + type: string + type: object + required: + - spec + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] +--- +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37942,7 +38624,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38158,7 +38840,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38311,7 +38993,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38503,7 +39185,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38629,7 +39311,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -38912,7 +39594,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39187,7 +39869,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39607,7 +40289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -39979,7 +40661,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40281,7 +40963,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -40516,7 +41198,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41319,7 +42001,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -43102,7 +43784,6 @@ spec: description: The informational elements that are arranged into the columns row-first. items: - description: The informational widget contained in the tile. properties: blank: description: A blank space. @@ -46281,8 +46962,6 @@ spec: description: The display widgets arranged horizontally in this row. items: - description: The informational widget contained in the - tile. properties: blank: description: A blank space. @@ -48040,7 +48719,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -48231,7 +48910,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -48522,7 +49201,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -48815,7 +49494,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49385,7 +50064,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49544,7 +50223,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -49920,7 +50599,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50102,7 +50781,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50441,7 +51120,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50699,7 +51378,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -50928,7 +51607,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51172,7 +51851,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51493,7 +52172,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51706,7 +52385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52186,7 +52865,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52941,7 +53620,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53123,7 +53802,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53467,7 +54146,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54236,7 +54915,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55234,7 +55913,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55730,7 +56409,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56708,7 +57387,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57124,7 +57803,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57349,7 +58028,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57706,7 +58385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -57883,7 +58562,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -58119,7 +58798,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58530,7 +59209,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58708,7 +59387,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -58989,7 +59668,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59887,7 +60566,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60140,7 +60819,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60340,7 +61019,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60518,7 +61197,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60659,7 +61338,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -60858,7 +61537,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61052,7 +61731,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61192,7 +61871,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61356,7 +62035,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -61927,7 +62606,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62103,7 +62782,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62299,7 +62978,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62469,7 +63148,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62802,7 +63481,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62988,7 +63667,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63191,7 +63870,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63743,7 +64422,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.76.0 + cnrm.cloud.google.com/version: 1.77.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/pkg/clients/generated/apis/compute/v1beta1/computeinstancegroupmanager_types.go b/pkg/clients/generated/apis/compute/v1beta1/computeinstancegroupmanager_types.go index 42d0eee46a..1d69f2b17d 100644 --- a/pkg/clients/generated/apis/compute/v1beta1/computeinstancegroupmanager_types.go +++ b/pkg/clients/generated/apis/compute/v1beta1/computeinstancegroupmanager_types.go @@ -122,11 +122,11 @@ type InstancegroupmanagerUpdatePolicy struct { // +optional InstanceRedistributionType *string `json:"instanceRedistributionType,omitempty"` - /* Specifies the intended number of instances to be created from the `instanceTemplate`. The final number of instances created from the template will be equal to: - If expressed as a fixed number, the minimum of either `targetSize.fixed` or `instanceGroupManager.targetSize` is used. - if expressed as a `percent`, the `targetSize` would be `(targetSize.percent/100 * InstanceGroupManager.targetSize)` If there is a remainder, the number is rounded. If unset, this version will update any remaining instances not updated by another `version`. Read [Starting a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) for more information. */ + /* The maximum number of instances that can be created above the specified `targetSize` during the update process. This value can be either a fixed number or, if the group has 10 or more instances, a percentage. If you set a percentage, the number of instances is rounded if necessary. The default value for `maxSurge` is a fixed value equal to the number of zones in which the managed instance group operates. At least one of either `maxSurge` or `maxUnavailable` must be greater than 0. Learn more about [`maxSurge`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_surge). */ // +optional MaxSurge *InstancegroupmanagerMaxSurge `json:"maxSurge,omitempty"` - /* Specifies the intended number of instances to be created from the `instanceTemplate`. The final number of instances created from the template will be equal to: - If expressed as a fixed number, the minimum of either `targetSize.fixed` or `instanceGroupManager.targetSize` is used. - if expressed as a `percent`, the `targetSize` would be `(targetSize.percent/100 * InstanceGroupManager.targetSize)` If there is a remainder, the number is rounded. If unset, this version will update any remaining instances not updated by another `version`. Read [Starting a canary update](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#starting_a_canary_update) for more information. */ + /* The maximum number of instances that can be unavailable during the update process. An instance is considered available if all of the following conditions are satisfied: - The instance's [status](/compute/docs/instances/checking-instance-status) is `RUNNING`. - If there is a [health check](/compute/docs/instance-groups/autohealing-instances-in-migs) on the instance group, the instance's health check status must be `HEALTHY` at least once. If there is no health check on the group, then the instance only needs to have a status of `RUNNING` to be considered available. This value can be either a fixed number or, if the group has 10 or more instances, a percentage. If you set a percentage, the number of instances is rounded if necessary. The default value for `maxUnavailable` is a fixed value equal to the number of zones in which the managed instance group operates. At least one of either `maxSurge` or `maxUnavailable` must be greater than 0. Learn more about [`maxUnavailable`](/compute/docs/instance-groups/rolling-out-updates-to-managed-instance-groups#max_unavailable). */ // +optional MaxUnavailable *InstancegroupmanagerMaxUnavailable `json:"maxUnavailable,omitempty"` diff --git a/pkg/clients/generated/apis/identityplatform/v1beta1/identityplatformconfig_types.go b/pkg/clients/generated/apis/identityplatform/v1beta1/identityplatformconfig_types.go new file mode 100644 index 0000000000..fdb7d33d53 --- /dev/null +++ b/pkg/clients/generated/apis/identityplatform/v1beta1/identityplatformconfig_types.go @@ -0,0 +1,556 @@ +// Copyright 2020 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// ---------------------------------------------------------------------------- +// +// *** AUTO GENERATED CODE *** AUTO GENERATED CODE *** +// +// ---------------------------------------------------------------------------- +// +// This file is automatically generated by Config Connector and manual +// changes will be clobbered when the file is regenerated. +// +// ---------------------------------------------------------------------------- + +// *** DISCLAIMER *** +// Config Connector's go-client for CRDs is currently in ALPHA, which means +// that future versions of the go-client may include breaking changes. +// Please try it out and give us feedback! + +package v1beta1 + +import ( + "github.com/GoogleCloudPlatform/k8s-config-connector/pkg/clients/generated/apis/k8s/v1alpha1" + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" +) + +type ConfigAnonymous struct { + /* Whether anonymous user auth is enabled for the project or not. */ + // +optional + Enabled *bool `json:"enabled,omitempty"` +} + +type ConfigBlockingFunctions struct { + /* Map of Trigger to event type. Key should be one of the supported event types: "beforeCreate", "beforeSignIn" */ + // +optional + Triggers map[string]ConfigTriggers `json:"triggers,omitempty"` +} + +type ConfigChangeEmailTemplate struct { + /* Email body */ + // +optional + Body *string `json:"body,omitempty"` + + /* Email body format Possible values: BODY_FORMAT_UNSPECIFIED, PLAIN_TEXT, HTML */ + // +optional + BodyFormat *string `json:"bodyFormat,omitempty"` + + /* Reply-to address */ + // +optional + ReplyTo *string `json:"replyTo,omitempty"` + + /* Sender display name */ + // +optional + SenderDisplayName *string `json:"senderDisplayName,omitempty"` + + /* Local part of From address */ + // +optional + SenderLocalPart *string `json:"senderLocalPart,omitempty"` + + /* Subject of the email */ + // +optional + Subject *string `json:"subject,omitempty"` +} + +type ConfigClient struct { + /* Configuration related to restricting a user's ability to affect their account. */ + // +optional + Permissions *ConfigPermissions `json:"permissions,omitempty"` +} + +type ConfigDnsInfo struct { + /* Whether to use custom domain. */ + // +optional + UseCustomDomain *bool `json:"useCustomDomain,omitempty"` +} + +type ConfigEmail struct { + /* Whether email auth is enabled for the project or not. */ + // +optional + Enabled *bool `json:"enabled,omitempty"` + + /* Whether a password is required for email auth or not. If true, both an email and password must be provided to sign in. If false, a user may sign in via either email/password or email link. */ + // +optional + PasswordRequired *bool `json:"passwordRequired,omitempty"` +} + +type ConfigMfa struct { + /* Whether MultiFactor Authentication has been enabled for this project. Possible values: STATE_UNSPECIFIED, DISABLED, ENABLED, MANDATORY */ + // +optional + State *string `json:"state,omitempty"` +} + +type ConfigMonitoring struct { + /* Configuration for logging requests made to this project to Stackdriver Logging */ + // +optional + RequestLogging *ConfigRequestLogging `json:"requestLogging,omitempty"` +} + +type ConfigMultiTenant struct { + /* Whether this project can have tenants or not. */ + // +optional + AllowTenants *bool `json:"allowTenants,omitempty"` + + /* */ + // +optional + DefaultTenantLocationRef *v1alpha1.ResourceRef `json:"defaultTenantLocationRef,omitempty"` +} + +type ConfigNotification struct { + /* Default locale used for email and SMS in IETF BCP 47 format. */ + // +optional + DefaultLocale *string `json:"defaultLocale,omitempty"` + + /* Options for email sending. */ + // +optional + SendEmail *ConfigSendEmail `json:"sendEmail,omitempty"` + + /* Options for SMS sending. */ + // +optional + SendSms *ConfigSendSms `json:"sendSms,omitempty"` +} + +type ConfigPassword struct { + /* Value of the field. Cannot be used if 'valueFrom' is specified. */ + // +optional + Value *string `json:"value,omitempty"` + + /* Source for the field's value. Cannot be used if 'value' is specified. */ + // +optional + ValueFrom *ConfigValueFrom `json:"valueFrom,omitempty"` +} + +type ConfigPermissions struct { + /* When true, end users cannot delete their account on the associated project through any of our API methods */ + // +optional + DisabledUserDeletion *bool `json:"disabledUserDeletion,omitempty"` + + /* When true, end users cannot sign up for a new account on the associated project through any of our API methods */ + // +optional + DisabledUserSignup *bool `json:"disabledUserSignup,omitempty"` +} + +type ConfigPhoneNumber struct { + /* Whether phone number auth is enabled for the project or not. */ + // +optional + Enabled *bool `json:"enabled,omitempty"` + + /* A map of that can be used for phone auth testing. */ + // +optional + TestPhoneNumbers map[string]string `json:"testPhoneNumbers,omitempty"` +} + +type ConfigQuota struct { + /* Quota for the Signup endpoint, if overwritten. Signup quota is measured in sign ups per project per hour per IP. */ + // +optional + SignUpQuotaConfig *ConfigSignUpQuotaConfig `json:"signUpQuotaConfig,omitempty"` +} + +type ConfigRequestLogging struct { + /* Whether logging is enabled for this project or not. */ + // +optional + Enabled *bool `json:"enabled,omitempty"` +} + +type ConfigResetPasswordTemplate struct { + /* Email body */ + // +optional + Body *string `json:"body,omitempty"` + + /* Email body format Possible values: BODY_FORMAT_UNSPECIFIED, PLAIN_TEXT, HTML */ + // +optional + BodyFormat *string `json:"bodyFormat,omitempty"` + + /* Reply-to address */ + // +optional + ReplyTo *string `json:"replyTo,omitempty"` + + /* Sender display name */ + // +optional + SenderDisplayName *string `json:"senderDisplayName,omitempty"` + + /* Local part of From address */ + // +optional + SenderLocalPart *string `json:"senderLocalPart,omitempty"` + + /* Subject of the email */ + // +optional + Subject *string `json:"subject,omitempty"` +} + +type ConfigRevertSecondFactorAdditionTemplate struct { + /* Email body */ + // +optional + Body *string `json:"body,omitempty"` + + /* Email body format Possible values: BODY_FORMAT_UNSPECIFIED, PLAIN_TEXT, HTML */ + // +optional + BodyFormat *string `json:"bodyFormat,omitempty"` + + /* Reply-to address */ + // +optional + ReplyTo *string `json:"replyTo,omitempty"` + + /* Sender display name */ + // +optional + SenderDisplayName *string `json:"senderDisplayName,omitempty"` + + /* Local part of From address */ + // +optional + SenderLocalPart *string `json:"senderLocalPart,omitempty"` + + /* Subject of the email */ + // +optional + Subject *string `json:"subject,omitempty"` +} + +type ConfigSendEmail struct { + /* action url in email template. */ + // +optional + CallbackUri *string `json:"callbackUri,omitempty"` + + /* Email template for change email */ + // +optional + ChangeEmailTemplate *ConfigChangeEmailTemplate `json:"changeEmailTemplate,omitempty"` + + /* Information of custom domain DNS verification. */ + // +optional + DnsInfo *ConfigDnsInfo `json:"dnsInfo,omitempty"` + + /* The method used for sending an email. Possible values: METHOD_UNSPECIFIED, DEFAULT, CUSTOM_SMTP */ + // +optional + Method *string `json:"method,omitempty"` + + /* Email template for reset password */ + // +optional + ResetPasswordTemplate *ConfigResetPasswordTemplate `json:"resetPasswordTemplate,omitempty"` + + /* Email template for reverting second factor addition emails */ + // +optional + RevertSecondFactorAdditionTemplate *ConfigRevertSecondFactorAdditionTemplate `json:"revertSecondFactorAdditionTemplate,omitempty"` + + /* Use a custom SMTP relay */ + // +optional + Smtp *ConfigSmtp `json:"smtp,omitempty"` + + /* Email template for verify email */ + // +optional + VerifyEmailTemplate *ConfigVerifyEmailTemplate `json:"verifyEmailTemplate,omitempty"` +} + +type ConfigSendSms struct { + /* Whether to use the accept_language header for SMS. */ + // +optional + UseDeviceLocale *bool `json:"useDeviceLocale,omitempty"` +} + +type ConfigSignIn struct { + /* Whether to allow more than one account to have the same email. */ + // +optional + AllowDuplicateEmails *bool `json:"allowDuplicateEmails,omitempty"` + + /* Configuration options related to authenticating an anonymous user. */ + // +optional + Anonymous *ConfigAnonymous `json:"anonymous,omitempty"` + + /* Configuration options related to authenticating a user by their email address. */ + // +optional + Email *ConfigEmail `json:"email,omitempty"` + + /* Configuration options related to authenticated a user by their phone number. */ + // +optional + PhoneNumber *ConfigPhoneNumber `json:"phoneNumber,omitempty"` +} + +type ConfigSignUpQuotaConfig struct { + /* Corresponds to the 'refill_token_count' field in QuotaServer config */ + // +optional + Quota *int `json:"quota,omitempty"` + + /* How long this quota will be active for */ + // +optional + QuotaDuration *string `json:"quotaDuration,omitempty"` + + /* When this quota will take affect */ + // +optional + StartTime *string `json:"startTime,omitempty"` +} + +type ConfigSmtp struct { + /* SMTP relay host */ + // +optional + Host *string `json:"host,omitempty"` + + /* SMTP relay password */ + // +optional + Password *ConfigPassword `json:"password,omitempty"` + + /* SMTP relay port */ + // +optional + Port *int `json:"port,omitempty"` + + /* SMTP security mode. Possible values: SECURITY_MODE_UNSPECIFIED, SSL, START_TLS */ + // +optional + SecurityMode *string `json:"securityMode,omitempty"` + + /* Sender email for the SMTP relay */ + // +optional + SenderEmail *string `json:"senderEmail,omitempty"` + + /* SMTP relay username */ + // +optional + Username *string `json:"username,omitempty"` +} + +type ConfigTriggers struct { + /* */ + // +optional + FunctionUriRef *v1alpha1.ResourceRef `json:"functionUriRef,omitempty"` + + /* When the trigger was changed. */ + // +optional + UpdateTime *string `json:"updateTime,omitempty"` +} + +type ConfigValueFrom struct { + /* Reference to a value with the given key in the given Secret in the resource's namespace. */ + // +optional + SecretKeyRef *v1alpha1.ResourceRef `json:"secretKeyRef,omitempty"` +} + +type ConfigVerifyEmailTemplate struct { + /* Email body */ + // +optional + Body *string `json:"body,omitempty"` + + /* Email body format Possible values: BODY_FORMAT_UNSPECIFIED, PLAIN_TEXT, HTML */ + // +optional + BodyFormat *string `json:"bodyFormat,omitempty"` + + /* Reply-to address */ + // +optional + ReplyTo *string `json:"replyTo,omitempty"` + + /* Sender display name */ + // +optional + SenderDisplayName *string `json:"senderDisplayName,omitempty"` + + /* Local part of From address */ + // +optional + SenderLocalPart *string `json:"senderLocalPart,omitempty"` + + /* Subject of the email */ + // +optional + Subject *string `json:"subject,omitempty"` +} + +type IdentityPlatformConfigSpec struct { + /* List of domains authorized for OAuth redirects */ + // +optional + AuthorizedDomains []string `json:"authorizedDomains,omitempty"` + + /* Configuration related to blocking functions. */ + // +optional + BlockingFunctions *ConfigBlockingFunctions `json:"blockingFunctions,omitempty"` + + /* Options related to how clients making requests on behalf of a project should be configured. */ + // +optional + Client *ConfigClient `json:"client,omitempty"` + + /* Configuration for this project's multi-factor authentication, including whether it is active and what factors can be used for the second factor */ + // +optional + Mfa *ConfigMfa `json:"mfa,omitempty"` + + /* Configuration related to monitoring project activity. */ + // +optional + Monitoring *ConfigMonitoring `json:"monitoring,omitempty"` + + /* Configuration related to multi-tenant functionality. */ + // +optional + MultiTenant *ConfigMultiTenant `json:"multiTenant,omitempty"` + + /* Configuration related to sending notifications to users. */ + // +optional + Notification *ConfigNotification `json:"notification,omitempty"` + + /* The Project that this resource belongs to. */ + ProjectRef v1alpha1.ResourceRef `json:"projectRef"` + + /* Configuration related to quotas. */ + // +optional + Quota *ConfigQuota `json:"quota,omitempty"` + + /* Configuration related to local sign in methods. */ + // +optional + SignIn *ConfigSignIn `json:"signIn,omitempty"` +} + +type ConfigChangeEmailTemplateStatus struct { + /* Output only. Whether the body or subject of the email is customized. */ + Customized bool `json:"customized,omitempty"` +} + +type ConfigClientStatus struct { + /* Output only. API key that can be used when making requests for this project. */ + ApiKey string `json:"apiKey,omitempty"` + + /* Output only. Firebase subdomain. */ + FirebaseSubdomain string `json:"firebaseSubdomain,omitempty"` +} + +type ConfigDnsInfoStatus struct { + /* Output only. The applied verified custom domain. */ + CustomDomain string `json:"customDomain,omitempty"` + + /* Output only. The current verification state of the custom domain. The custom domain will only be used once the domain verification is successful. Possible values: VERIFICATION_STATE_UNSPECIFIED, NOT_STARTED, IN_PROGRESS, FAILED, SUCCEEDED */ + CustomDomainState string `json:"customDomainState,omitempty"` + + /* Output only. The timestamp of initial request for the current domain verification. */ + DomainVerificationRequestTime string `json:"domainVerificationRequestTime,omitempty"` + + /* Output only. The custom domain that's to be verified. */ + PendingCustomDomain string `json:"pendingCustomDomain,omitempty"` +} + +type ConfigEmailStatus struct { + /* Output only. Hash config information. */ + HashConfig ConfigHashConfigStatus `json:"hashConfig,omitempty"` +} + +type ConfigHashConfigStatus struct { + /* Output only. Different password hash algorithms used in Identity Toolkit. Possible values: HASH_ALGORITHM_UNSPECIFIED, HMAC_SHA256, HMAC_SHA1, HMAC_MD5, SCRYPT, PBKDF_SHA1, MD5, HMAC_SHA512, SHA1, BCRYPT, PBKDF2_SHA256, SHA256, SHA512, STANDARD_SCRYPT */ + Algorithm string `json:"algorithm,omitempty"` + + /* Output only. Memory cost for hash calculation. Used by scrypt and other similar password derivation algorithms. See https://tools.ietf.org/html/rfc7914 for explanation of field. */ + MemoryCost int `json:"memoryCost,omitempty"` + + /* Output only. How many rounds for hash calculation. Used by scrypt and other similar password derivation algorithms. */ + Rounds int `json:"rounds,omitempty"` + + /* Output only. Non-printable character to be inserted between the salt and plain text password in base64. */ + SaltSeparator string `json:"saltSeparator,omitempty"` + + /* Output only. Signer key in base64. */ + SignerKey string `json:"signerKey,omitempty"` +} + +type ConfigNotificationStatus struct { + /* */ + SendEmail ConfigSendEmailStatus `json:"sendEmail,omitempty"` + + /* */ + SendSms ConfigSendSmsStatus `json:"sendSms,omitempty"` +} + +type ConfigResetPasswordTemplateStatus struct { + /* Output only. Whether the body or subject of the email is customized. */ + Customized bool `json:"customized,omitempty"` +} + +type ConfigRevertSecondFactorAdditionTemplateStatus struct { + /* Output only. Whether the body or subject of the email is customized. */ + Customized bool `json:"customized,omitempty"` +} + +type ConfigSendEmailStatus struct { + /* */ + ChangeEmailTemplate ConfigChangeEmailTemplateStatus `json:"changeEmailTemplate,omitempty"` + + /* */ + DnsInfo ConfigDnsInfoStatus `json:"dnsInfo,omitempty"` + + /* */ + ResetPasswordTemplate ConfigResetPasswordTemplateStatus `json:"resetPasswordTemplate,omitempty"` + + /* */ + RevertSecondFactorAdditionTemplate ConfigRevertSecondFactorAdditionTemplateStatus `json:"revertSecondFactorAdditionTemplate,omitempty"` + + /* */ + VerifyEmailTemplate ConfigVerifyEmailTemplateStatus `json:"verifyEmailTemplate,omitempty"` +} + +type ConfigSendSmsStatus struct { + /* Output only. The template to use when sending an SMS. */ + SmsTemplate ConfigSmsTemplateStatus `json:"smsTemplate,omitempty"` +} + +type ConfigSignInStatus struct { + /* */ + Email ConfigEmailStatus `json:"email,omitempty"` + + /* Output only. Hash config information. */ + HashConfig ConfigHashConfigStatus `json:"hashConfig,omitempty"` +} + +type ConfigSmsTemplateStatus struct { + /* Output only. The SMS's content. Can contain the following placeholders which will be replaced with the appropriate values: %APP_NAME% - For Android or iOS apps, the app's display name. For web apps, the domain hosting the application. %LOGIN_CODE% - The OOB code being sent in the SMS. */ + Content string `json:"content,omitempty"` +} + +type ConfigVerifyEmailTemplateStatus struct { + /* Output only. Whether the body or subject of the email is customized. */ + Customized bool `json:"customized,omitempty"` +} + +type IdentityPlatformConfigStatus struct { + /* Conditions represent the latest available observations of the + IdentityPlatformConfig's current state. */ + Conditions []v1alpha1.Condition `json:"conditions,omitempty"` + /* */ + Client ConfigClientStatus `json:"client,omitempty"` + /* */ + Notification ConfigNotificationStatus `json:"notification,omitempty"` + /* ObservedGeneration is the generation of the resource that was most recently observed by the Config Connector controller. If this is equal to metadata.generation, then that means that the current reported status reflects the most recent desired state of the resource. */ + ObservedGeneration int `json:"observedGeneration,omitempty"` + /* */ + SignIn ConfigSignInStatus `json:"signIn,omitempty"` + /* Output only. The subtype of this config. Possible values: SUBTYPE_UNSPECIFIED, IDENTITY_PLATFORM, FIREBASE_AUTH */ + Subtype string `json:"subtype,omitempty"` +} + +// +genclient +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object + +// IdentityPlatformConfig is the Schema for the identityplatform API +// +k8s:openapi-gen=true +type IdentityPlatformConfig struct { + metav1.TypeMeta `json:",inline"` + metav1.ObjectMeta `json:"metadata,omitempty"` + + Spec IdentityPlatformConfigSpec `json:"spec,omitempty"` + Status IdentityPlatformConfigStatus `json:"status,omitempty"` +} + +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object + +// IdentityPlatformConfigList contains a list of IdentityPlatformConfig +type IdentityPlatformConfigList struct { + metav1.TypeMeta `json:",inline"` + metav1.ListMeta `json:"metadata,omitempty"` + Items []IdentityPlatformConfig `json:"items"` +} + +func init() { + SchemeBuilder.Register(&IdentityPlatformConfig{}, &IdentityPlatformConfigList{}) +} diff --git a/pkg/clients/generated/apis/identityplatform/v1beta1/register.go b/pkg/clients/generated/apis/identityplatform/v1beta1/register.go index fa319b6476..4c4c4bae27 100644 --- a/pkg/clients/generated/apis/identityplatform/v1beta1/register.go +++ b/pkg/clients/generated/apis/identityplatform/v1beta1/register.go @@ -53,6 +53,12 @@ var ( // AddToScheme is a global function that registers this API group & version to a scheme AddToScheme = SchemeBuilder.AddToScheme + IdentityPlatformConfigGVK = schema.GroupVersionKind{ + Group: SchemeGroupVersion.Group, + Version: SchemeGroupVersion.Version, + Kind: reflect.TypeOf(IdentityPlatformConfig{}).Name(), + } + IdentityPlatformOAuthIDPConfigGVK = schema.GroupVersionKind{ Group: SchemeGroupVersion.Group, Version: SchemeGroupVersion.Version, diff --git a/pkg/clients/generated/apis/identityplatform/v1beta1/zz_generated.deepcopy.go b/pkg/clients/generated/apis/identityplatform/v1beta1/zz_generated.deepcopy.go index 7bde1d7b96..4eba27d70f 100644 --- a/pkg/clients/generated/apis/identityplatform/v1beta1/zz_generated.deepcopy.go +++ b/pkg/clients/generated/apis/identityplatform/v1beta1/zz_generated.deepcopy.go @@ -29,6 +29,1126 @@ import ( runtime "k8s.io/apimachinery/pkg/runtime" ) +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigAnonymous) DeepCopyInto(out *ConfigAnonymous) { + *out = *in + if in.Enabled != nil { + in, out := &in.Enabled, &out.Enabled + *out = new(bool) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigAnonymous. +func (in *ConfigAnonymous) DeepCopy() *ConfigAnonymous { + if in == nil { + return nil + } + out := new(ConfigAnonymous) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigBlockingFunctions) DeepCopyInto(out *ConfigBlockingFunctions) { + *out = *in + if in.Triggers != nil { + in, out := &in.Triggers, &out.Triggers + *out = make(map[string]ConfigTriggers, len(*in)) + for key, val := range *in { + (*out)[key] = *val.DeepCopy() + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigBlockingFunctions. +func (in *ConfigBlockingFunctions) DeepCopy() *ConfigBlockingFunctions { + if in == nil { + return nil + } + out := new(ConfigBlockingFunctions) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigChangeEmailTemplate) DeepCopyInto(out *ConfigChangeEmailTemplate) { + *out = *in + if in.Body != nil { + in, out := &in.Body, &out.Body + *out = new(string) + **out = **in + } + if in.BodyFormat != nil { + in, out := &in.BodyFormat, &out.BodyFormat + *out = new(string) + **out = **in + } + if in.ReplyTo != nil { + in, out := &in.ReplyTo, &out.ReplyTo + *out = new(string) + **out = **in + } + if in.SenderDisplayName != nil { + in, out := &in.SenderDisplayName, &out.SenderDisplayName + *out = new(string) + **out = **in + } + if in.SenderLocalPart != nil { + in, out := &in.SenderLocalPart, &out.SenderLocalPart + *out = new(string) + **out = **in + } + if in.Subject != nil { + in, out := &in.Subject, &out.Subject + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigChangeEmailTemplate. +func (in *ConfigChangeEmailTemplate) DeepCopy() *ConfigChangeEmailTemplate { + if in == nil { + return nil + } + out := new(ConfigChangeEmailTemplate) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigChangeEmailTemplateStatus) DeepCopyInto(out *ConfigChangeEmailTemplateStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigChangeEmailTemplateStatus. +func (in *ConfigChangeEmailTemplateStatus) DeepCopy() *ConfigChangeEmailTemplateStatus { + if in == nil { + return nil + } + out := new(ConfigChangeEmailTemplateStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigClient) DeepCopyInto(out *ConfigClient) { + *out = *in + if in.Permissions != nil { + in, out := &in.Permissions, &out.Permissions + *out = new(ConfigPermissions) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigClient. +func (in *ConfigClient) DeepCopy() *ConfigClient { + if in == nil { + return nil + } + out := new(ConfigClient) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigClientStatus) DeepCopyInto(out *ConfigClientStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigClientStatus. +func (in *ConfigClientStatus) DeepCopy() *ConfigClientStatus { + if in == nil { + return nil + } + out := new(ConfigClientStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigDnsInfo) DeepCopyInto(out *ConfigDnsInfo) { + *out = *in + if in.UseCustomDomain != nil { + in, out := &in.UseCustomDomain, &out.UseCustomDomain + *out = new(bool) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigDnsInfo. +func (in *ConfigDnsInfo) DeepCopy() *ConfigDnsInfo { + if in == nil { + return nil + } + out := new(ConfigDnsInfo) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigDnsInfoStatus) DeepCopyInto(out *ConfigDnsInfoStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigDnsInfoStatus. +func (in *ConfigDnsInfoStatus) DeepCopy() *ConfigDnsInfoStatus { + if in == nil { + return nil + } + out := new(ConfigDnsInfoStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigEmail) DeepCopyInto(out *ConfigEmail) { + *out = *in + if in.Enabled != nil { + in, out := &in.Enabled, &out.Enabled + *out = new(bool) + **out = **in + } + if in.PasswordRequired != nil { + in, out := &in.PasswordRequired, &out.PasswordRequired + *out = new(bool) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigEmail. +func (in *ConfigEmail) DeepCopy() *ConfigEmail { + if in == nil { + return nil + } + out := new(ConfigEmail) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigEmailStatus) DeepCopyInto(out *ConfigEmailStatus) { + *out = *in + out.HashConfig = in.HashConfig + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigEmailStatus. +func (in *ConfigEmailStatus) DeepCopy() *ConfigEmailStatus { + if in == nil { + return nil + } + out := new(ConfigEmailStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigHashConfigStatus) DeepCopyInto(out *ConfigHashConfigStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigHashConfigStatus. +func (in *ConfigHashConfigStatus) DeepCopy() *ConfigHashConfigStatus { + if in == nil { + return nil + } + out := new(ConfigHashConfigStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigMfa) DeepCopyInto(out *ConfigMfa) { + *out = *in + if in.State != nil { + in, out := &in.State, &out.State + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigMfa. +func (in *ConfigMfa) DeepCopy() *ConfigMfa { + if in == nil { + return nil + } + out := new(ConfigMfa) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigMonitoring) DeepCopyInto(out *ConfigMonitoring) { + *out = *in + if in.RequestLogging != nil { + in, out := &in.RequestLogging, &out.RequestLogging + *out = new(ConfigRequestLogging) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigMonitoring. +func (in *ConfigMonitoring) DeepCopy() *ConfigMonitoring { + if in == nil { + return nil + } + out := new(ConfigMonitoring) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigMultiTenant) DeepCopyInto(out *ConfigMultiTenant) { + *out = *in + if in.AllowTenants != nil { + in, out := &in.AllowTenants, &out.AllowTenants + *out = new(bool) + **out = **in + } + if in.DefaultTenantLocationRef != nil { + in, out := &in.DefaultTenantLocationRef, &out.DefaultTenantLocationRef + *out = new(v1alpha1.ResourceRef) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigMultiTenant. +func (in *ConfigMultiTenant) DeepCopy() *ConfigMultiTenant { + if in == nil { + return nil + } + out := new(ConfigMultiTenant) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigNotification) DeepCopyInto(out *ConfigNotification) { + *out = *in + if in.DefaultLocale != nil { + in, out := &in.DefaultLocale, &out.DefaultLocale + *out = new(string) + **out = **in + } + if in.SendEmail != nil { + in, out := &in.SendEmail, &out.SendEmail + *out = new(ConfigSendEmail) + (*in).DeepCopyInto(*out) + } + if in.SendSms != nil { + in, out := &in.SendSms, &out.SendSms + *out = new(ConfigSendSms) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigNotification. +func (in *ConfigNotification) DeepCopy() *ConfigNotification { + if in == nil { + return nil + } + out := new(ConfigNotification) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigNotificationStatus) DeepCopyInto(out *ConfigNotificationStatus) { + *out = *in + out.SendEmail = in.SendEmail + out.SendSms = in.SendSms + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigNotificationStatus. +func (in *ConfigNotificationStatus) DeepCopy() *ConfigNotificationStatus { + if in == nil { + return nil + } + out := new(ConfigNotificationStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigPassword) DeepCopyInto(out *ConfigPassword) { + *out = *in + if in.Value != nil { + in, out := &in.Value, &out.Value + *out = new(string) + **out = **in + } + if in.ValueFrom != nil { + in, out := &in.ValueFrom, &out.ValueFrom + *out = new(ConfigValueFrom) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigPassword. +func (in *ConfigPassword) DeepCopy() *ConfigPassword { + if in == nil { + return nil + } + out := new(ConfigPassword) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigPermissions) DeepCopyInto(out *ConfigPermissions) { + *out = *in + if in.DisabledUserDeletion != nil { + in, out := &in.DisabledUserDeletion, &out.DisabledUserDeletion + *out = new(bool) + **out = **in + } + if in.DisabledUserSignup != nil { + in, out := &in.DisabledUserSignup, &out.DisabledUserSignup + *out = new(bool) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigPermissions. +func (in *ConfigPermissions) DeepCopy() *ConfigPermissions { + if in == nil { + return nil + } + out := new(ConfigPermissions) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigPhoneNumber) DeepCopyInto(out *ConfigPhoneNumber) { + *out = *in + if in.Enabled != nil { + in, out := &in.Enabled, &out.Enabled + *out = new(bool) + **out = **in + } + if in.TestPhoneNumbers != nil { + in, out := &in.TestPhoneNumbers, &out.TestPhoneNumbers + *out = make(map[string]string, len(*in)) + for key, val := range *in { + (*out)[key] = val + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigPhoneNumber. +func (in *ConfigPhoneNumber) DeepCopy() *ConfigPhoneNumber { + if in == nil { + return nil + } + out := new(ConfigPhoneNumber) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigQuota) DeepCopyInto(out *ConfigQuota) { + *out = *in + if in.SignUpQuotaConfig != nil { + in, out := &in.SignUpQuotaConfig, &out.SignUpQuotaConfig + *out = new(ConfigSignUpQuotaConfig) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigQuota. +func (in *ConfigQuota) DeepCopy() *ConfigQuota { + if in == nil { + return nil + } + out := new(ConfigQuota) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigRequestLogging) DeepCopyInto(out *ConfigRequestLogging) { + *out = *in + if in.Enabled != nil { + in, out := &in.Enabled, &out.Enabled + *out = new(bool) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigRequestLogging. +func (in *ConfigRequestLogging) DeepCopy() *ConfigRequestLogging { + if in == nil { + return nil + } + out := new(ConfigRequestLogging) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigResetPasswordTemplate) DeepCopyInto(out *ConfigResetPasswordTemplate) { + *out = *in + if in.Body != nil { + in, out := &in.Body, &out.Body + *out = new(string) + **out = **in + } + if in.BodyFormat != nil { + in, out := &in.BodyFormat, &out.BodyFormat + *out = new(string) + **out = **in + } + if in.ReplyTo != nil { + in, out := &in.ReplyTo, &out.ReplyTo + *out = new(string) + **out = **in + } + if in.SenderDisplayName != nil { + in, out := &in.SenderDisplayName, &out.SenderDisplayName + *out = new(string) + **out = **in + } + if in.SenderLocalPart != nil { + in, out := &in.SenderLocalPart, &out.SenderLocalPart + *out = new(string) + **out = **in + } + if in.Subject != nil { + in, out := &in.Subject, &out.Subject + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigResetPasswordTemplate. +func (in *ConfigResetPasswordTemplate) DeepCopy() *ConfigResetPasswordTemplate { + if in == nil { + return nil + } + out := new(ConfigResetPasswordTemplate) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigResetPasswordTemplateStatus) DeepCopyInto(out *ConfigResetPasswordTemplateStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigResetPasswordTemplateStatus. +func (in *ConfigResetPasswordTemplateStatus) DeepCopy() *ConfigResetPasswordTemplateStatus { + if in == nil { + return nil + } + out := new(ConfigResetPasswordTemplateStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigRevertSecondFactorAdditionTemplate) DeepCopyInto(out *ConfigRevertSecondFactorAdditionTemplate) { + *out = *in + if in.Body != nil { + in, out := &in.Body, &out.Body + *out = new(string) + **out = **in + } + if in.BodyFormat != nil { + in, out := &in.BodyFormat, &out.BodyFormat + *out = new(string) + **out = **in + } + if in.ReplyTo != nil { + in, out := &in.ReplyTo, &out.ReplyTo + *out = new(string) + **out = **in + } + if in.SenderDisplayName != nil { + in, out := &in.SenderDisplayName, &out.SenderDisplayName + *out = new(string) + **out = **in + } + if in.SenderLocalPart != nil { + in, out := &in.SenderLocalPart, &out.SenderLocalPart + *out = new(string) + **out = **in + } + if in.Subject != nil { + in, out := &in.Subject, &out.Subject + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigRevertSecondFactorAdditionTemplate. +func (in *ConfigRevertSecondFactorAdditionTemplate) DeepCopy() *ConfigRevertSecondFactorAdditionTemplate { + if in == nil { + return nil + } + out := new(ConfigRevertSecondFactorAdditionTemplate) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigRevertSecondFactorAdditionTemplateStatus) DeepCopyInto(out *ConfigRevertSecondFactorAdditionTemplateStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigRevertSecondFactorAdditionTemplateStatus. +func (in *ConfigRevertSecondFactorAdditionTemplateStatus) DeepCopy() *ConfigRevertSecondFactorAdditionTemplateStatus { + if in == nil { + return nil + } + out := new(ConfigRevertSecondFactorAdditionTemplateStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSendEmail) DeepCopyInto(out *ConfigSendEmail) { + *out = *in + if in.CallbackUri != nil { + in, out := &in.CallbackUri, &out.CallbackUri + *out = new(string) + **out = **in + } + if in.ChangeEmailTemplate != nil { + in, out := &in.ChangeEmailTemplate, &out.ChangeEmailTemplate + *out = new(ConfigChangeEmailTemplate) + (*in).DeepCopyInto(*out) + } + if in.DnsInfo != nil { + in, out := &in.DnsInfo, &out.DnsInfo + *out = new(ConfigDnsInfo) + (*in).DeepCopyInto(*out) + } + if in.Method != nil { + in, out := &in.Method, &out.Method + *out = new(string) + **out = **in + } + if in.ResetPasswordTemplate != nil { + in, out := &in.ResetPasswordTemplate, &out.ResetPasswordTemplate + *out = new(ConfigResetPasswordTemplate) + (*in).DeepCopyInto(*out) + } + if in.RevertSecondFactorAdditionTemplate != nil { + in, out := &in.RevertSecondFactorAdditionTemplate, &out.RevertSecondFactorAdditionTemplate + *out = new(ConfigRevertSecondFactorAdditionTemplate) + (*in).DeepCopyInto(*out) + } + if in.Smtp != nil { + in, out := &in.Smtp, &out.Smtp + *out = new(ConfigSmtp) + (*in).DeepCopyInto(*out) + } + if in.VerifyEmailTemplate != nil { + in, out := &in.VerifyEmailTemplate, &out.VerifyEmailTemplate + *out = new(ConfigVerifyEmailTemplate) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSendEmail. +func (in *ConfigSendEmail) DeepCopy() *ConfigSendEmail { + if in == nil { + return nil + } + out := new(ConfigSendEmail) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSendEmailStatus) DeepCopyInto(out *ConfigSendEmailStatus) { + *out = *in + out.ChangeEmailTemplate = in.ChangeEmailTemplate + out.DnsInfo = in.DnsInfo + out.ResetPasswordTemplate = in.ResetPasswordTemplate + out.RevertSecondFactorAdditionTemplate = in.RevertSecondFactorAdditionTemplate + out.VerifyEmailTemplate = in.VerifyEmailTemplate + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSendEmailStatus. +func (in *ConfigSendEmailStatus) DeepCopy() *ConfigSendEmailStatus { + if in == nil { + return nil + } + out := new(ConfigSendEmailStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSendSms) DeepCopyInto(out *ConfigSendSms) { + *out = *in + if in.UseDeviceLocale != nil { + in, out := &in.UseDeviceLocale, &out.UseDeviceLocale + *out = new(bool) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSendSms. +func (in *ConfigSendSms) DeepCopy() *ConfigSendSms { + if in == nil { + return nil + } + out := new(ConfigSendSms) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSendSmsStatus) DeepCopyInto(out *ConfigSendSmsStatus) { + *out = *in + out.SmsTemplate = in.SmsTemplate + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSendSmsStatus. +func (in *ConfigSendSmsStatus) DeepCopy() *ConfigSendSmsStatus { + if in == nil { + return nil + } + out := new(ConfigSendSmsStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSignIn) DeepCopyInto(out *ConfigSignIn) { + *out = *in + if in.AllowDuplicateEmails != nil { + in, out := &in.AllowDuplicateEmails, &out.AllowDuplicateEmails + *out = new(bool) + **out = **in + } + if in.Anonymous != nil { + in, out := &in.Anonymous, &out.Anonymous + *out = new(ConfigAnonymous) + (*in).DeepCopyInto(*out) + } + if in.Email != nil { + in, out := &in.Email, &out.Email + *out = new(ConfigEmail) + (*in).DeepCopyInto(*out) + } + if in.PhoneNumber != nil { + in, out := &in.PhoneNumber, &out.PhoneNumber + *out = new(ConfigPhoneNumber) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSignIn. +func (in *ConfigSignIn) DeepCopy() *ConfigSignIn { + if in == nil { + return nil + } + out := new(ConfigSignIn) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSignInStatus) DeepCopyInto(out *ConfigSignInStatus) { + *out = *in + out.Email = in.Email + out.HashConfig = in.HashConfig + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSignInStatus. +func (in *ConfigSignInStatus) DeepCopy() *ConfigSignInStatus { + if in == nil { + return nil + } + out := new(ConfigSignInStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSignUpQuotaConfig) DeepCopyInto(out *ConfigSignUpQuotaConfig) { + *out = *in + if in.Quota != nil { + in, out := &in.Quota, &out.Quota + *out = new(int) + **out = **in + } + if in.QuotaDuration != nil { + in, out := &in.QuotaDuration, &out.QuotaDuration + *out = new(string) + **out = **in + } + if in.StartTime != nil { + in, out := &in.StartTime, &out.StartTime + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSignUpQuotaConfig. +func (in *ConfigSignUpQuotaConfig) DeepCopy() *ConfigSignUpQuotaConfig { + if in == nil { + return nil + } + out := new(ConfigSignUpQuotaConfig) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSmsTemplateStatus) DeepCopyInto(out *ConfigSmsTemplateStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSmsTemplateStatus. +func (in *ConfigSmsTemplateStatus) DeepCopy() *ConfigSmsTemplateStatus { + if in == nil { + return nil + } + out := new(ConfigSmsTemplateStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigSmtp) DeepCopyInto(out *ConfigSmtp) { + *out = *in + if in.Host != nil { + in, out := &in.Host, &out.Host + *out = new(string) + **out = **in + } + if in.Password != nil { + in, out := &in.Password, &out.Password + *out = new(ConfigPassword) + (*in).DeepCopyInto(*out) + } + if in.Port != nil { + in, out := &in.Port, &out.Port + *out = new(int) + **out = **in + } + if in.SecurityMode != nil { + in, out := &in.SecurityMode, &out.SecurityMode + *out = new(string) + **out = **in + } + if in.SenderEmail != nil { + in, out := &in.SenderEmail, &out.SenderEmail + *out = new(string) + **out = **in + } + if in.Username != nil { + in, out := &in.Username, &out.Username + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigSmtp. +func (in *ConfigSmtp) DeepCopy() *ConfigSmtp { + if in == nil { + return nil + } + out := new(ConfigSmtp) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigTriggers) DeepCopyInto(out *ConfigTriggers) { + *out = *in + if in.FunctionUriRef != nil { + in, out := &in.FunctionUriRef, &out.FunctionUriRef + *out = new(v1alpha1.ResourceRef) + **out = **in + } + if in.UpdateTime != nil { + in, out := &in.UpdateTime, &out.UpdateTime + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigTriggers. +func (in *ConfigTriggers) DeepCopy() *ConfigTriggers { + if in == nil { + return nil + } + out := new(ConfigTriggers) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigValueFrom) DeepCopyInto(out *ConfigValueFrom) { + *out = *in + if in.SecretKeyRef != nil { + in, out := &in.SecretKeyRef, &out.SecretKeyRef + *out = new(v1alpha1.ResourceRef) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigValueFrom. +func (in *ConfigValueFrom) DeepCopy() *ConfigValueFrom { + if in == nil { + return nil + } + out := new(ConfigValueFrom) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigVerifyEmailTemplate) DeepCopyInto(out *ConfigVerifyEmailTemplate) { + *out = *in + if in.Body != nil { + in, out := &in.Body, &out.Body + *out = new(string) + **out = **in + } + if in.BodyFormat != nil { + in, out := &in.BodyFormat, &out.BodyFormat + *out = new(string) + **out = **in + } + if in.ReplyTo != nil { + in, out := &in.ReplyTo, &out.ReplyTo + *out = new(string) + **out = **in + } + if in.SenderDisplayName != nil { + in, out := &in.SenderDisplayName, &out.SenderDisplayName + *out = new(string) + **out = **in + } + if in.SenderLocalPart != nil { + in, out := &in.SenderLocalPart, &out.SenderLocalPart + *out = new(string) + **out = **in + } + if in.Subject != nil { + in, out := &in.Subject, &out.Subject + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigVerifyEmailTemplate. +func (in *ConfigVerifyEmailTemplate) DeepCopy() *ConfigVerifyEmailTemplate { + if in == nil { + return nil + } + out := new(ConfigVerifyEmailTemplate) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfigVerifyEmailTemplateStatus) DeepCopyInto(out *ConfigVerifyEmailTemplateStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfigVerifyEmailTemplateStatus. +func (in *ConfigVerifyEmailTemplateStatus) DeepCopy() *ConfigVerifyEmailTemplateStatus { + if in == nil { + return nil + } + out := new(ConfigVerifyEmailTemplateStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IdentityPlatformConfig) DeepCopyInto(out *IdentityPlatformConfig) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) + in.Spec.DeepCopyInto(&out.Spec) + in.Status.DeepCopyInto(&out.Status) + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IdentityPlatformConfig. +func (in *IdentityPlatformConfig) DeepCopy() *IdentityPlatformConfig { + if in == nil { + return nil + } + out := new(IdentityPlatformConfig) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *IdentityPlatformConfig) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IdentityPlatformConfigList) DeepCopyInto(out *IdentityPlatformConfigList) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ListMeta.DeepCopyInto(&out.ListMeta) + if in.Items != nil { + in, out := &in.Items, &out.Items + *out = make([]IdentityPlatformConfig, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IdentityPlatformConfigList. +func (in *IdentityPlatformConfigList) DeepCopy() *IdentityPlatformConfigList { + if in == nil { + return nil + } + out := new(IdentityPlatformConfigList) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *IdentityPlatformConfigList) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IdentityPlatformConfigSpec) DeepCopyInto(out *IdentityPlatformConfigSpec) { + *out = *in + if in.AuthorizedDomains != nil { + in, out := &in.AuthorizedDomains, &out.AuthorizedDomains + *out = make([]string, len(*in)) + copy(*out, *in) + } + if in.BlockingFunctions != nil { + in, out := &in.BlockingFunctions, &out.BlockingFunctions + *out = new(ConfigBlockingFunctions) + (*in).DeepCopyInto(*out) + } + if in.Client != nil { + in, out := &in.Client, &out.Client + *out = new(ConfigClient) + (*in).DeepCopyInto(*out) + } + if in.Mfa != nil { + in, out := &in.Mfa, &out.Mfa + *out = new(ConfigMfa) + (*in).DeepCopyInto(*out) + } + if in.Monitoring != nil { + in, out := &in.Monitoring, &out.Monitoring + *out = new(ConfigMonitoring) + (*in).DeepCopyInto(*out) + } + if in.MultiTenant != nil { + in, out := &in.MultiTenant, &out.MultiTenant + *out = new(ConfigMultiTenant) + (*in).DeepCopyInto(*out) + } + if in.Notification != nil { + in, out := &in.Notification, &out.Notification + *out = new(ConfigNotification) + (*in).DeepCopyInto(*out) + } + out.ProjectRef = in.ProjectRef + if in.Quota != nil { + in, out := &in.Quota, &out.Quota + *out = new(ConfigQuota) + (*in).DeepCopyInto(*out) + } + if in.SignIn != nil { + in, out := &in.SignIn, &out.SignIn + *out = new(ConfigSignIn) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IdentityPlatformConfigSpec. +func (in *IdentityPlatformConfigSpec) DeepCopy() *IdentityPlatformConfigSpec { + if in == nil { + return nil + } + out := new(IdentityPlatformConfigSpec) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IdentityPlatformConfigStatus) DeepCopyInto(out *IdentityPlatformConfigStatus) { + *out = *in + if in.Conditions != nil { + in, out := &in.Conditions, &out.Conditions + *out = make([]v1alpha1.Condition, len(*in)) + copy(*out, *in) + } + out.Client = in.Client + out.Notification = in.Notification + out.SignIn = in.SignIn + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IdentityPlatformConfigStatus. +func (in *IdentityPlatformConfigStatus) DeepCopy() *IdentityPlatformConfigStatus { + if in == nil { + return nil + } + out := new(IdentityPlatformConfigStatus) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *IdentityPlatformOAuthIDPConfig) DeepCopyInto(out *IdentityPlatformOAuthIDPConfig) { *out = *in diff --git a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/fake/fake_identityplatform_client.go b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/fake/fake_identityplatform_client.go index 82c67b231c..70f775f5b4 100644 --- a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/fake/fake_identityplatform_client.go +++ b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/fake/fake_identityplatform_client.go @@ -31,6 +31,10 @@ type FakeIdentityplatformV1beta1 struct { *testing.Fake } +func (c *FakeIdentityplatformV1beta1) IdentityPlatformConfigs(namespace string) v1beta1.IdentityPlatformConfigInterface { + return &FakeIdentityPlatformConfigs{c, namespace} +} + func (c *FakeIdentityplatformV1beta1) IdentityPlatformOAuthIDPConfigs(namespace string) v1beta1.IdentityPlatformOAuthIDPConfigInterface { return &FakeIdentityPlatformOAuthIDPConfigs{c, namespace} } diff --git a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/fake/fake_identityplatformconfig.go b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/fake/fake_identityplatformconfig.go new file mode 100644 index 0000000000..79d71bcbf9 --- /dev/null +++ b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/fake/fake_identityplatformconfig.go @@ -0,0 +1,145 @@ +// Copyright 2020 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// *** DISCLAIMER *** +// Config Connector's go-client for CRDs is currently in ALPHA, which means +// that future versions of the go-client may include breaking changes. +// Please try it out and give us feedback! + +// Code generated by main. DO NOT EDIT. + +package fake + +import ( + "context" + + v1beta1 "github.com/GoogleCloudPlatform/k8s-config-connector/pkg/clients/generated/apis/identityplatform/v1beta1" + v1 "k8s.io/apimachinery/pkg/apis/meta/v1" + labels "k8s.io/apimachinery/pkg/labels" + schema "k8s.io/apimachinery/pkg/runtime/schema" + types "k8s.io/apimachinery/pkg/types" + watch "k8s.io/apimachinery/pkg/watch" + testing "k8s.io/client-go/testing" +) + +// FakeIdentityPlatformConfigs implements IdentityPlatformConfigInterface +type FakeIdentityPlatformConfigs struct { + Fake *FakeIdentityplatformV1beta1 + ns string +} + +var identityplatformconfigsResource = schema.GroupVersionResource{Group: "identityplatform.cnrm.cloud.google.com", Version: "v1beta1", Resource: "identityplatformconfigs"} + +var identityplatformconfigsKind = schema.GroupVersionKind{Group: "identityplatform.cnrm.cloud.google.com", Version: "v1beta1", Kind: "IdentityPlatformConfig"} + +// Get takes name of the identityPlatformConfig, and returns the corresponding identityPlatformConfig object, and an error if there is any. +func (c *FakeIdentityPlatformConfigs) Get(ctx context.Context, name string, options v1.GetOptions) (result *v1beta1.IdentityPlatformConfig, err error) { + obj, err := c.Fake. + Invokes(testing.NewGetAction(identityplatformconfigsResource, c.ns, name), &v1beta1.IdentityPlatformConfig{}) + + if obj == nil { + return nil, err + } + return obj.(*v1beta1.IdentityPlatformConfig), err +} + +// List takes label and field selectors, and returns the list of IdentityPlatformConfigs that match those selectors. +func (c *FakeIdentityPlatformConfigs) List(ctx context.Context, opts v1.ListOptions) (result *v1beta1.IdentityPlatformConfigList, err error) { + obj, err := c.Fake. + Invokes(testing.NewListAction(identityplatformconfigsResource, identityplatformconfigsKind, c.ns, opts), &v1beta1.IdentityPlatformConfigList{}) + + if obj == nil { + return nil, err + } + + label, _, _ := testing.ExtractFromListOptions(opts) + if label == nil { + label = labels.Everything() + } + list := &v1beta1.IdentityPlatformConfigList{ListMeta: obj.(*v1beta1.IdentityPlatformConfigList).ListMeta} + for _, item := range obj.(*v1beta1.IdentityPlatformConfigList).Items { + if label.Matches(labels.Set(item.Labels)) { + list.Items = append(list.Items, item) + } + } + return list, err +} + +// Watch returns a watch.Interface that watches the requested identityPlatformConfigs. +func (c *FakeIdentityPlatformConfigs) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { + return c.Fake. + InvokesWatch(testing.NewWatchAction(identityplatformconfigsResource, c.ns, opts)) + +} + +// Create takes the representation of a identityPlatformConfig and creates it. Returns the server's representation of the identityPlatformConfig, and an error, if there is any. +func (c *FakeIdentityPlatformConfigs) Create(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.CreateOptions) (result *v1beta1.IdentityPlatformConfig, err error) { + obj, err := c.Fake. + Invokes(testing.NewCreateAction(identityplatformconfigsResource, c.ns, identityPlatformConfig), &v1beta1.IdentityPlatformConfig{}) + + if obj == nil { + return nil, err + } + return obj.(*v1beta1.IdentityPlatformConfig), err +} + +// Update takes the representation of a identityPlatformConfig and updates it. Returns the server's representation of the identityPlatformConfig, and an error, if there is any. +func (c *FakeIdentityPlatformConfigs) Update(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.UpdateOptions) (result *v1beta1.IdentityPlatformConfig, err error) { + obj, err := c.Fake. + Invokes(testing.NewUpdateAction(identityplatformconfigsResource, c.ns, identityPlatformConfig), &v1beta1.IdentityPlatformConfig{}) + + if obj == nil { + return nil, err + } + return obj.(*v1beta1.IdentityPlatformConfig), err +} + +// UpdateStatus was generated because the type contains a Status member. +// Add a +genclient:noStatus comment above the type to avoid generating UpdateStatus(). +func (c *FakeIdentityPlatformConfigs) UpdateStatus(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.UpdateOptions) (*v1beta1.IdentityPlatformConfig, error) { + obj, err := c.Fake. + Invokes(testing.NewUpdateSubresourceAction(identityplatformconfigsResource, "status", c.ns, identityPlatformConfig), &v1beta1.IdentityPlatformConfig{}) + + if obj == nil { + return nil, err + } + return obj.(*v1beta1.IdentityPlatformConfig), err +} + +// Delete takes name of the identityPlatformConfig and deletes it. Returns an error if one occurs. +func (c *FakeIdentityPlatformConfigs) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { + _, err := c.Fake. + Invokes(testing.NewDeleteActionWithOptions(identityplatformconfigsResource, c.ns, name, opts), &v1beta1.IdentityPlatformConfig{}) + + return err +} + +// DeleteCollection deletes a collection of objects. +func (c *FakeIdentityPlatformConfigs) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { + action := testing.NewDeleteCollectionAction(identityplatformconfigsResource, c.ns, listOpts) + + _, err := c.Fake.Invokes(action, &v1beta1.IdentityPlatformConfigList{}) + return err +} + +// Patch applies the patch and returns the patched identityPlatformConfig. +func (c *FakeIdentityPlatformConfigs) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.IdentityPlatformConfig, err error) { + obj, err := c.Fake. + Invokes(testing.NewPatchSubresourceAction(identityplatformconfigsResource, c.ns, name, pt, data, subresources...), &v1beta1.IdentityPlatformConfig{}) + + if obj == nil { + return nil, err + } + return obj.(*v1beta1.IdentityPlatformConfig), err +} diff --git a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/generated_expansion.go b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/generated_expansion.go index 575d9298b0..b3bc583630 100644 --- a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/generated_expansion.go +++ b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/generated_expansion.go @@ -21,6 +21,8 @@ package v1beta1 +type IdentityPlatformConfigExpansion interface{} + type IdentityPlatformOAuthIDPConfigExpansion interface{} type IdentityPlatformTenantExpansion interface{} diff --git a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/identityplatform_client.go b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/identityplatform_client.go index c8c04d1cc1..5e7818fb21 100644 --- a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/identityplatform_client.go +++ b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/identityplatform_client.go @@ -31,6 +31,7 @@ import ( type IdentityplatformV1beta1Interface interface { RESTClient() rest.Interface + IdentityPlatformConfigsGetter IdentityPlatformOAuthIDPConfigsGetter IdentityPlatformTenantsGetter IdentityPlatformTenantOAuthIDPConfigsGetter @@ -41,6 +42,10 @@ type IdentityplatformV1beta1Client struct { restClient rest.Interface } +func (c *IdentityplatformV1beta1Client) IdentityPlatformConfigs(namespace string) IdentityPlatformConfigInterface { + return newIdentityPlatformConfigs(c, namespace) +} + func (c *IdentityplatformV1beta1Client) IdentityPlatformOAuthIDPConfigs(namespace string) IdentityPlatformOAuthIDPConfigInterface { return newIdentityPlatformOAuthIDPConfigs(c, namespace) } diff --git a/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/identityplatformconfig.go b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/identityplatformconfig.go new file mode 100644 index 0000000000..dc85be710f --- /dev/null +++ b/pkg/clients/generated/client/clientset/versioned/typed/identityplatform/v1beta1/identityplatformconfig.go @@ -0,0 +1,198 @@ +// Copyright 2020 Google LLC +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// *** DISCLAIMER *** +// Config Connector's go-client for CRDs is currently in ALPHA, which means +// that future versions of the go-client may include breaking changes. +// Please try it out and give us feedback! + +// Code generated by main. DO NOT EDIT. + +package v1beta1 + +import ( + "context" + "time" + + v1beta1 "github.com/GoogleCloudPlatform/k8s-config-connector/pkg/clients/generated/apis/identityplatform/v1beta1" + scheme "github.com/GoogleCloudPlatform/k8s-config-connector/pkg/clients/generated/client/clientset/versioned/scheme" + v1 "k8s.io/apimachinery/pkg/apis/meta/v1" + types "k8s.io/apimachinery/pkg/types" + watch "k8s.io/apimachinery/pkg/watch" + rest "k8s.io/client-go/rest" +) + +// IdentityPlatformConfigsGetter has a method to return a IdentityPlatformConfigInterface. +// A group's client should implement this interface. +type IdentityPlatformConfigsGetter interface { + IdentityPlatformConfigs(namespace string) IdentityPlatformConfigInterface +} + +// IdentityPlatformConfigInterface has methods to work with IdentityPlatformConfig resources. +type IdentityPlatformConfigInterface interface { + Create(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.CreateOptions) (*v1beta1.IdentityPlatformConfig, error) + Update(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.UpdateOptions) (*v1beta1.IdentityPlatformConfig, error) + UpdateStatus(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.UpdateOptions) (*v1beta1.IdentityPlatformConfig, error) + Delete(ctx context.Context, name string, opts v1.DeleteOptions) error + DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error + Get(ctx context.Context, name string, opts v1.GetOptions) (*v1beta1.IdentityPlatformConfig, error) + List(ctx context.Context, opts v1.ListOptions) (*v1beta1.IdentityPlatformConfigList, error) + Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) + Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.IdentityPlatformConfig, err error) + IdentityPlatformConfigExpansion +} + +// identityPlatformConfigs implements IdentityPlatformConfigInterface +type identityPlatformConfigs struct { + client rest.Interface + ns string +} + +// newIdentityPlatformConfigs returns a IdentityPlatformConfigs +func newIdentityPlatformConfigs(c *IdentityplatformV1beta1Client, namespace string) *identityPlatformConfigs { + return &identityPlatformConfigs{ + client: c.RESTClient(), + ns: namespace, + } +} + +// Get takes name of the identityPlatformConfig, and returns the corresponding identityPlatformConfig object, and an error if there is any. +func (c *identityPlatformConfigs) Get(ctx context.Context, name string, options v1.GetOptions) (result *v1beta1.IdentityPlatformConfig, err error) { + result = &v1beta1.IdentityPlatformConfig{} + err = c.client.Get(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + Name(name). + VersionedParams(&options, scheme.ParameterCodec). + Do(ctx). + Into(result) + return +} + +// List takes label and field selectors, and returns the list of IdentityPlatformConfigs that match those selectors. +func (c *identityPlatformConfigs) List(ctx context.Context, opts v1.ListOptions) (result *v1beta1.IdentityPlatformConfigList, err error) { + var timeout time.Duration + if opts.TimeoutSeconds != nil { + timeout = time.Duration(*opts.TimeoutSeconds) * time.Second + } + result = &v1beta1.IdentityPlatformConfigList{} + err = c.client.Get(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + VersionedParams(&opts, scheme.ParameterCodec). + Timeout(timeout). + Do(ctx). + Into(result) + return +} + +// Watch returns a watch.Interface that watches the requested identityPlatformConfigs. +func (c *identityPlatformConfigs) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { + var timeout time.Duration + if opts.TimeoutSeconds != nil { + timeout = time.Duration(*opts.TimeoutSeconds) * time.Second + } + opts.Watch = true + return c.client.Get(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + VersionedParams(&opts, scheme.ParameterCodec). + Timeout(timeout). + Watch(ctx) +} + +// Create takes the representation of a identityPlatformConfig and creates it. Returns the server's representation of the identityPlatformConfig, and an error, if there is any. +func (c *identityPlatformConfigs) Create(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.CreateOptions) (result *v1beta1.IdentityPlatformConfig, err error) { + result = &v1beta1.IdentityPlatformConfig{} + err = c.client.Post(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + VersionedParams(&opts, scheme.ParameterCodec). + Body(identityPlatformConfig). + Do(ctx). + Into(result) + return +} + +// Update takes the representation of a identityPlatformConfig and updates it. Returns the server's representation of the identityPlatformConfig, and an error, if there is any. +func (c *identityPlatformConfigs) Update(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.UpdateOptions) (result *v1beta1.IdentityPlatformConfig, err error) { + result = &v1beta1.IdentityPlatformConfig{} + err = c.client.Put(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + Name(identityPlatformConfig.Name). + VersionedParams(&opts, scheme.ParameterCodec). + Body(identityPlatformConfig). + Do(ctx). + Into(result) + return +} + +// UpdateStatus was generated because the type contains a Status member. +// Add a +genclient:noStatus comment above the type to avoid generating UpdateStatus(). +func (c *identityPlatformConfigs) UpdateStatus(ctx context.Context, identityPlatformConfig *v1beta1.IdentityPlatformConfig, opts v1.UpdateOptions) (result *v1beta1.IdentityPlatformConfig, err error) { + result = &v1beta1.IdentityPlatformConfig{} + err = c.client.Put(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + Name(identityPlatformConfig.Name). + SubResource("status"). + VersionedParams(&opts, scheme.ParameterCodec). + Body(identityPlatformConfig). + Do(ctx). + Into(result) + return +} + +// Delete takes name of the identityPlatformConfig and deletes it. Returns an error if one occurs. +func (c *identityPlatformConfigs) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { + return c.client.Delete(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + Name(name). + Body(&opts). + Do(ctx). + Error() +} + +// DeleteCollection deletes a collection of objects. +func (c *identityPlatformConfigs) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { + var timeout time.Duration + if listOpts.TimeoutSeconds != nil { + timeout = time.Duration(*listOpts.TimeoutSeconds) * time.Second + } + return c.client.Delete(). + Namespace(c.ns). + Resource("identityplatformconfigs"). + VersionedParams(&listOpts, scheme.ParameterCodec). + Timeout(timeout). + Body(&opts). + Do(ctx). + Error() +} + +// Patch applies the patch and returns the patched identityPlatformConfig. +func (c *identityPlatformConfigs) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1beta1.IdentityPlatformConfig, err error) { + result = &v1beta1.IdentityPlatformConfig{} + err = c.client.Patch(pt). + Namespace(c.ns). + Resource("identityplatformconfigs"). + Name(name). + SubResource(subresources...). + VersionedParams(&opts, scheme.ParameterCodec). + Body(data). + Do(ctx). + Into(result) + return +} diff --git a/samples/resources/identityplatformconfig/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/samples/resources/identityplatformconfig/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml new file mode 100644 index 0000000000..a362e557b7 --- /dev/null +++ b/samples/resources/identityplatformconfig/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml @@ -0,0 +1,32 @@ +# Copyright 2021 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: cloudfunctions.cnrm.cloud.google.com/v1beta1 +kind: CloudFunctionsFunction +metadata: + name: identityplatformconfig-dep +spec: + region: "us-west2" + runtime: "nodejs8" + availableMemoryMb: 128 + sourceArchiveUrl: "gs://aaa-dont-delete-dcl-cloud-functions-testing/http_trigger.zip" + timeout: "60s" + entryPoint: "helloGET" + ingressSettings: "ALLOW_INTERNAL_ONLY" + maxInstances: 10 + httpsTrigger: + securityLevel: "SECURE_OPTIONAL" + projectRef: + # Replace "${PROJECT_ID?}" with your project ID + external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/identityplatformconfig/identityplatform_v1beta1_identityplatformconfig.yaml b/samples/resources/identityplatformconfig/identityplatform_v1beta1_identityplatformconfig.yaml new file mode 100644 index 0000000000..aef521fe92 --- /dev/null +++ b/samples/resources/identityplatformconfig/identityplatform_v1beta1_identityplatformconfig.yaml @@ -0,0 +1,123 @@ +# Copyright 2021 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: identityplatform.cnrm.cloud.google.com/v1beta1 +kind: IdentityPlatformConfig +metadata: + name: identityplatformconfig-sample +spec: + projectRef: + # Replace "${PROJECT_ID?}" with your project ID + external: "projects/${PROJECT_ID?}" + signIn: + email: + enabled: true + passwordRequired: true + phoneNumber: + enabled: true + testPhoneNumbers: + +1 555-555-5555: "000000" + anonymous: + enabled: true + allowDuplicateEmails: true + notification: + sendEmail: + method: "CUSTOM_SMTP" + smtp: + senderEmail: "magic-modules-guitar-testing@system.gserviceaccount.com" + host: "system.gserviceaccount.com" + port: 8080 + username: "sample-username" + password: + value: "sample-password" + securityMode: "SSL" + resetPasswordTemplate: + senderLocalPart: "noreply" + subject: "Reset your password for %APP_NAME%" + senderDisplayName: "DCL Team" + body: "

Hello,

\n

Follow this link to reset your %APP_NAME% password\ + \ for your %EMAIL% account.

\n

%LINK%

\n

If\ + \ you didn’t ask to reset your password, you can ignore this email.

\n\ +

Thanks,

\n

Your %APP_NAME% team

" + bodyFormat: "PLAIN_TEXT" + replyTo: "noreply" + verifyEmailTemplate: + senderLocalPart: "noreply" + subject: "Verify your email for %APP_NAME%" + senderDisplayName: "DCL Team" + body: "

Hello %DISPLAY_NAME%,

\n

Follow this link to verify your email\ + \ address.

\n

%LINK%

\n

If you didn’t ask\ + \ to verify this address, you can ignore this email.

\n

Thanks,

\n\ +

Your %APP_NAME% team

" + bodyFormat: "PLAIN_TEXT" + replyTo: "noreply" + changeEmailTemplate: + senderLocalPart: "noreply" + subject: "Your sign-in email was changed for %APP_NAME%" + senderDisplayName: "DCL Team" + body: "

Hello %DISPLAY_NAME%,

\n

Your sign-in email for %APP_NAME%\ + \ was changed to %NEW_EMAIL%.

\n

If you didn’t ask to change your email,\ + \ follow this link to reset your sign-in email.

\n

%LINK%

\n\ +

Thanks,

\n

Your %APP_NAME% team

" + bodyFormat: "PLAIN_TEXT" + replyTo: "noreply" + callbackUri: "https://config-connector-sample.firebaseapp.com/__/auth/action" + dnsInfo: + useCustomDomain: true + revertSecondFactorAdditionTemplate: + senderLocalPart: "noreply" + subject: "You've added 2 step verification to your %APP_NAME% account." + senderDisplayName: "DCL Team" + body: "

Hello %DISPLAY_NAME%,

\n

Your account in %APP_NAME% has been\ + \ updated with a phone number %SECOND_FACTOR% for 2-step verification.

\n\ +

If you didn't add this phone number for 2-step verification, click the\ + \ link below to remove it.

\n

%LINK%

\n

Thanks,

\n\ +

Your %APP_NAME% team

" + bodyFormat: "PLAIN_TEXT" + replyTo: "noreply" + sendSms: + useDeviceLocale: true + defaultLocale: "en" + quota: + signUpQuotaConfig: + quota: 1 + startTime: "2022-08-10T00:22:56.247547Z" + quotaDuration: "604800s" + monitoring: + requestLogging: + enabled: true + multiTenant: + allowTenants: true + defaultTenantLocationRef: + kind: Folder + name: "identityplatformconfig-dep" + authorizedDomains: + - "localhost" + - "config-connector-sample.firebaseapp.com" + subtype: "IDENTITY_PLATFORM" + client: + permissions: + disabledUserSignup: true + disabledUserDeletion: true + mfa: + state: "ENABLED" + blockingFunctions: + triggers: + beforeCreate: + functionUriRef: + name: "identityplatformconfig-dep" + forwardInboundCredentials: + idToken: true + accessToken: true + refereshToken: true diff --git a/samples/resources/identityplatformconfig/resourcemanager_v1beta1_folder.yaml b/samples/resources/identityplatformconfig/resourcemanager_v1beta1_folder.yaml new file mode 100644 index 0000000000..5eff30d574 --- /dev/null +++ b/samples/resources/identityplatformconfig/resourcemanager_v1beta1_folder.yaml @@ -0,0 +1,23 @@ +# Copyright 2021 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 +kind: Folder +metadata: + name: identityplatformconfig-dep +spec: + displayName: Default Tenant Location + organizationRef: + # Replace "${ORG_ID?}" with the numeric ID for your organization + external: "${ORG_ID?}"