Day3: extract_seq.ipynb

{
 "cells": [
  {
   "cell_type": "code",
   "execution_count": 14,
   "id": "87e62511",
   "metadata": {},
   "outputs": [],
   "source": [
    "#load the biopython SeqIO module\n",
    "from Bio import SeqIO\n",
    "#load the biopython Enterz module\n",
    "from Bio import Entrez"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 15,
   "id": "9db2b42c",
   "metadata": {},
   "outputs": [],
   "source": [
    "#Set the email\n",
    "Entrez.eamil='sekhwal@gmail.com'"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 28,
   "id": "0793f102",
   "metadata": {},
   "outputs": [],
   "source": [
    "#GI:number\n",
    "#database: nuccore\n",
    "handle=Entrez.efetch(db='nuccore',id='34577062')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 29,
   "id": "5ed2316b",
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "Seq-entry ::= set {\n",
      "  level 1,\n",
      "  class nuc-prot,\n",
      "  descr {\n",
      "    source {\n",
      "      genome genomic,\n",
      "      org {\n",
      "        taxname \"Homo sapiens\",\n",
      "        common \"human\",\n",
      "        db {\n",
      "          {\n",
      "            db \"taxon\",\n",
      "            tag id 9606\n",
      "          }\n",
      "        },\n",
      "        orgname {\n",
      "          name binomial {\n",
      "            genus \"Homo\",\n",
      "            species \"sapiens\"\n",
      "          },\n",
      "          lineage \"Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;\n",
      " Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;\n",
      " Catarrhini; Hominidae; Homo\",\n",
      "          gcode 1,\n",
      "          mgcode 2,\n",
      "          div \"PRI\"\n",
      "        }\n",
      "      },\n",
      "      subtype {\n",
      "        {\n",
      "          subtype chromosome,\n",
      "          name \"1\"\n",
      "        },\n",
      "        {\n",
      "          subtype map,\n",
      "          name \"1cen-q12\"\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 19115993,\n",
      "        article {\n",
      "          title {\n",
      "            name \"Association analyses of the interaction between the ADSS and\n",
      " ATM genes with schizophrenia in a Chinese population.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Zhang\",\n",
      "                  initials \"F.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Xu\",\n",
      "                  initials \"Y.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Liu\",\n",
      "                  initials \"P.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Fan\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Huang\",\n",
      "                  initials \"X.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Sun\",\n",
      "                  initials \"G.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Song\",\n",
      "                  initials \"Y.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Sham\",\n",
      "                  initials \"P.C.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Institute of Neurological disorders, Tsinghua\n",
      " University, Department of Psychiatry, Yuquan Hospital, Tsinghua University,\n",
      " Bejing, 100049, PR China. zhfq@tsinghua.edu.cn\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"BMC Med. Genet.\",\n",
      "              ml-jta \"BMC Med Genet\",\n",
      "              issn \"1471-2350\",\n",
      "              name \"BMC medical genetics\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 2008\n",
      "              },\n",
      "              volume \"9\",\n",
      "              pages \"119\",\n",
      "              language \"eng\",\n",
      "              pubstatus epublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus received,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 7,\n",
      "                    day 27\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus accepted,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 12,\n",
      "                    day 30\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus aheadofprint,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 12,\n",
      "                    day 30\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 2009,\n",
      "                    month 1,\n",
      "                    day 1,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 2009,\n",
      "                    month 1,\n",
      "                    day 1,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 2009,\n",
      "                    month 3,\n",
      "                    day 19,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pii \"1471-2350-9-119\",\n",
      "            doi \"10.1186/1471-2350-9-119\",\n",
      "            pubmed 19115993,\n",
      "            other {\n",
      "              db \"pmc\",\n",
      "              tag str \"PMC2654671\"\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      },\n",
      "      comment \"GeneRIF: These findings suggest that the combined effects of\n",
      " the polymorphisms in the ADSS and ATM genes may confer susceptibility to the\n",
      " development of schizophrenia in a Chinese population~GeneRIF: Observational\n",
      " study of gene-disease association and gene-gene interaction. (HuGE Navigator)\"\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 18721483,\n",
      "        article {\n",
      "          title {\n",
      "            name \"An association study of ADSS gene polymorphisms with\n",
      " schizophrenia.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Zhang\",\n",
      "                  initials \"F.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Sham\",\n",
      "                  initials \"P.C.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Fan\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Xu\",\n",
      "                  initials \"Y.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Huang\",\n",
      "                  initials \"X.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"So\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Song\",\n",
      "                  initials \"Y.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Liu\",\n",
      "                  initials \"P.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Institute of Neurological disorders, Tsinghua\n",
      " University; Department of Psychiatry, Yuquan Hospital, Tsinghua University,\n",
      " Bejing, 100049, PR China. liupozi@tsinghua.edu.cn.\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"Behav Brain Funct\",\n",
      "              ml-jta \"Behav Brain Funct\",\n",
      "              issn \"1744-9081\",\n",
      "              name \"Behavioral and brain functions : BBF\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 2008\n",
      "              },\n",
      "              volume \"4\",\n",
      "              pages \"39\",\n",
      "              language \"eng\",\n",
      "              pubstatus epublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus received,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 4,\n",
      "                    day 20\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus accepted,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 8,\n",
      "                    day 24\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus aheadofprint,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 8,\n",
      "                    day 24\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 8,\n",
      "                    day 30,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 8,\n",
      "                    day 30,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 8,\n",
      "                    day 30,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pii \"1744-9081-4-39\",\n",
      "            doi \"10.1186/1744-9081-4-39\",\n",
      "            pubmed 18721483,\n",
      "            other {\n",
      "              db \"pmc\",\n",
      "              tag str \"PMC2553416\"\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      },\n",
      "      comment \"GeneRIF: Observational study of gene-disease association. (HuGE\n",
      " Navigator)\"\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 18469177,\n",
      "        article {\n",
      "          title {\n",
      "            name \"Effect of a new non-cleavable substrate analog on wild-type\n",
      " and serine mutants in the signature sequence of adenylosuccinate lyase of\n",
      " Bacillus subtilis and Homo sapiens.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Sivendran\",\n",
      "                  initials \"S.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Colman\",\n",
      "                  initials \"R.F.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Department of Chemistry and Biochemistry, University of\n",
      " Delaware, Newark, Delaware 19716, USA.\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"Protein Sci.\",\n",
      "              ml-jta \"Protein Sci\",\n",
      "              issn \"1469-896X\",\n",
      "              name \"Protein science : a publication of the Protein Society\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 2008,\n",
      "                month 7\n",
      "              },\n",
      "              volume \"17\",\n",
      "              issue \"7\",\n",
      "              pages \"1162-1174\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus aheadofprint,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 5,\n",
      "                    day 9\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 5,\n",
      "                    day 13,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 8,\n",
      "                    day 30,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 2008,\n",
      "                    month 5,\n",
      "                    day 13,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pii \"ps.034777.108\",\n",
      "            doi \"10.1110/ps.034777.108\",\n",
      "            pubmed 18469177,\n",
      "            other {\n",
      "              db \"pmc\",\n",
      "              tag str \"PMC2442012\"\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      },\n",
      "      comment \"GeneRIF: Kinetic data reveal that human Ser(289) and B.\n",
      " subtilis Ser(262) and Ser(263) are essential for catalysis, while the ability\n",
      " of these Ser mutants to bind APBADP suggests that they do not contribute to\n",
      " substrate affinity\"\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 15786719,\n",
      "        article {\n",
      "          title {\n",
      "            name \"Molecular cloning and characterization of a novel muscle\n",
      " adenylosuccinate synthetase, AdSSL1, from human bone marrow stromal cells.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Sun\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Li\",\n",
      "                  initials \"N.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Wang\",\n",
      "                  initials \"X.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Chen\",\n",
      "                  initials \"T.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Shi\",\n",
      "                  initials \"L.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Zhang\",\n",
      "                  initials \"L.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Wang\",\n",
      "                  initials \"J.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Wan\",\n",
      "                  initials \"T.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Cao\",\n",
      "                  initials \"X.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Institute of Immunology, Zhejiang University, Hangzhou,\n",
      " Zhejiang, PR China.\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"Mol. Cell. Biochem.\",\n",
      "              ml-jta \"Mol Cell Biochem\",\n",
      "              issn \"0300-8177\",\n",
      "              name \"Molecular and cellular biochemistry\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 2005,\n",
      "                month 1\n",
      "              },\n",
      "              volume \"269\",\n",
      "              issue \"1-2\",\n",
      "              pages \"85-94\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 2005,\n",
      "                    month 3,\n",
      "                    day 25,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 2005,\n",
      "                    month 9,\n",
      "                    day 2,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 2005,\n",
      "                    month 3,\n",
      "                    day 25,\n",
      "                    hour 9,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pubmed 15786719\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 8887278,\n",
      "        article {\n",
      "          title {\n",
      "            name \"Purine nucleotide cycle in rat renal cortex and medulla\n",
      " under conditions that mimic normal and low oxygen supply.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Stepinski\",\n",
      "                  initials \"J.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Pawelczyk\",\n",
      "                  initials \"T.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Bizon\",\n",
      "                  initials \"D.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Angielski\",\n",
      "                  initials \"S.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Department of Clinical Biochemistry, Medical University\n",
      " of Gdansk, Poland.\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"Kidney Int.\",\n",
      "              ml-jta \"Kidney Int\",\n",
      "              issn \"0085-2538\",\n",
      "              name \"Kidney international\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 1996,\n",
      "                month 10\n",
      "              },\n",
      "              volume \"50\",\n",
      "              issue \"4\",\n",
      "              pages \"1195-1201\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 1996,\n",
      "                    month 10,\n",
      "                    day 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 1996,\n",
      "                    month 10,\n",
      "                    day 1,\n",
      "                    hour 0,\n",
      "                    minute 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 1996,\n",
      "                    month 10,\n",
      "                    day 1,\n",
      "                    hour 0,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pubmed 8887278\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 4436310,\n",
      "        article {\n",
      "          title {\n",
      "            name \"Human adenylosuccinate synthetase. Partial purification,\n",
      " kinetic and regulatory properties of the enzyme from placenta.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Van der Weyden\",\n",
      "                  initials \"M.B.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Kelly\",\n",
      "                  initials \"W.N.\"\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"J. Biol. Chem.\",\n",
      "              ml-jta \"J Biol Chem\",\n",
      "              issn \"0021-9258\",\n",
      "              name \"The Journal of biological chemistry\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 1974,\n",
      "                month 11,\n",
      "                day 25\n",
      "              },\n",
      "              volume \"249\",\n",
      "              issue \"22\",\n",
      "              pages \"7282-7289\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 1974,\n",
      "                    month 11,\n",
      "                    day 25\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 1974,\n",
      "                    month 11,\n",
      "                    day 25,\n",
      "                    hour 0,\n",
      "                    minute 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 1974,\n",
      "                    month 11,\n",
      "                    day 25,\n",
      "                    hour 0,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pubmed 4436310\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 2004783,\n",
      "        article {\n",
      "          title {\n",
      "            name \"A gene correcting the defect in the CHO mutant Ade -H,\n",
      " deficient in a branch point enzyme (adenylosuccinate synthetase) of de novo\n",
      " purine biosynthesis, is located on the long arm of chromosome 1.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Lai\",\n",
      "                  initials \"L.W.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Hart\",\n",
      "                  initials \"I.M.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Patterson\",\n",
      "                  initials \"D.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Eleanor Roosevelt Institute for Cancer Research,\n",
      " Denver, Colorado 80206.\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"Genomics\",\n",
      "              ml-jta \"Genomics\",\n",
      "              issn \"0888-7543\",\n",
      "              name \"Genomics\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 1991,\n",
      "                month 2\n",
      "              },\n",
      "              volume \"9\",\n",
      "              issue \"2\",\n",
      "              pages \"322-328\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 1991,\n",
      "                    month 2,\n",
      "                    day 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 1991,\n",
      "                    month 2,\n",
      "                    day 1,\n",
      "                    hour 0,\n",
      "                    minute 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 1991,\n",
      "                    month 2,\n",
      "                    day 1,\n",
      "                    hour 0,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pubmed 2004783,\n",
      "            pii \"0888-7543(91)90260-L\"\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 1592113,\n",
      "        article {\n",
      "          title {\n",
      "            name \"Cloning and characterization of the cDNA encoding human\n",
      " adenylosuccinate synthetase.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Powell\",\n",
      "                  initials \"S.M.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Zalkin\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Dixon\",\n",
      "                  initials \"J.E.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Department of Biochemistry, Purdue University, West\n",
      " Lafayette, IN 49707.\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"FEBS Lett.\",\n",
      "              ml-jta \"FEBS Lett\",\n",
      "              issn \"0014-5793\",\n",
      "              name \"FEBS letters\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 1992,\n",
      "                month 5,\n",
      "                day 25\n",
      "              },\n",
      "              volume \"303\",\n",
      "              issue \"1\",\n",
      "              pages \"4-10\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 1992,\n",
      "                    month 5,\n",
      "                    day 25\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 1992,\n",
      "                    month 5,\n",
      "                    day 25,\n",
      "                    hour 0,\n",
      "                    minute 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 1992,\n",
      "                    month 5,\n",
      "                    day 25,\n",
      "                    hour 0,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pubmed 1592113,\n",
      "            pii \"0014-5793(92)80465-S\"\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 1574589,\n",
      "        article {\n",
      "          title {\n",
      "            name \"De novo purine nucleotide biosynthesis.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Zalkin\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Dixon\",\n",
      "                  initials \"J.E.\"\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            affil str \"Department of Biochemistry, Purdue University, West\n",
      " Lafayette, Indiana 47907.\"\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"Prog. Nucleic Acid Res. Mol. Biol.\",\n",
      "              ml-jta \"Prog Nucleic Acid Res Mol Biol\",\n",
      "              issn \"0079-6603\",\n",
      "              name \"Progress in nucleic acid research and molecular biology\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 1992\n",
      "              },\n",
      "              volume \"42\",\n",
      "              pages \"259-287\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 1992,\n",
      "                    month 1,\n",
      "                    day 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 1992,\n",
      "                    month 1,\n",
      "                    day 1,\n",
      "                    hour 0,\n",
      "                    minute 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 1992,\n",
      "                    month 1,\n",
      "                    day 1,\n",
      "                    hour 0,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pubmed 1574589\n",
      "          }\n",
      "        }\n",
      "      },\n",
      "      comment \"Review article\"\n",
      "    },\n",
      "    pub {\n",
      "      pub {\n",
      "        pmid 648524,\n",
      "        article {\n",
      "          title {\n",
      "            name \"Interaction of adenylosuccinate synthetase with F-actin.\"\n",
      "          },\n",
      "          authors {\n",
      "            names std {\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Ogawa\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Shiraki\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Matsuda\",\n",
      "                  initials \"Y.\"\n",
      "                }\n",
      "              },\n",
      "              {\n",
      "                name name {\n",
      "                  last \"Nakagawa\",\n",
      "                  initials \"H.\"\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          from journal {\n",
      "            title {\n",
      "              iso-jta \"Eur. J. Biochem.\",\n",
      "              ml-jta \"Eur J Biochem\",\n",
      "              issn \"0014-2956\",\n",
      "              name \"European journal of biochemistry / FEBS\"\n",
      "            },\n",
      "            imp {\n",
      "              date std {\n",
      "                year 1978,\n",
      "                month 4,\n",
      "                day 17\n",
      "              },\n",
      "              volume \"85\",\n",
      "              issue \"2\",\n",
      "              pages \"331-337\",\n",
      "              language \"eng\",\n",
      "              pubstatus ppublish,\n",
      "              history {\n",
      "                {\n",
      "                  pubstatus pubmed,\n",
      "                  date std {\n",
      "                    year 1978,\n",
      "                    month 4,\n",
      "                    day 17\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus medline,\n",
      "                  date std {\n",
      "                    year 1978,\n",
      "                    month 4,\n",
      "                    day 17,\n",
      "                    hour 0,\n",
      "                    minute 1\n",
      "                  }\n",
      "                },\n",
      "                {\n",
      "                  pubstatus other,\n",
      "                  date std {\n",
      "                    year 1978,\n",
      "                    month 4,\n",
      "                    day 17,\n",
      "                    hour 0,\n",
      "                    minute 0\n",
      "                  }\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          },\n",
      "          ids {\n",
      "            pubmed 648524\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    comment \"~Summary: Adenylosuccinate synthetase catalyzes the first\n",
      " committed step in the conversion of IMP to AMP [provided by RefSeq]\",\n",
      "    user {\n",
      "      type str \"RefGeneTracking\",\n",
      "      data {\n",
      "        {\n",
      "          label str \"Status\",\n",
      "          data str \"Reviewed\"\n",
      "        },\n",
      "        {\n",
      "          label str \"Assembly\",\n",
      "          data fields {\n",
      "            {\n",
      "              label id 0,\n",
      "              data fields {\n",
      "                {\n",
      "                  label str \"accession\",\n",
      "                  data str \"BC012356.1\"\n",
      "                },\n",
      "                {\n",
      "                  label str \"gi\",\n",
      "                  data int 15214463\n",
      "                }\n",
      "              }\n",
      "            },\n",
      "            {\n",
      "              label id 0,\n",
      "              data fields {\n",
      "                {\n",
      "                  label str \"accession\",\n",
      "                  data str \"BG700800.1\"\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    update-date std {\n",
      "      year 2010,\n",
      "      month 10,\n",
      "      day 10\n",
      "    }\n",
      "  },\n",
      "  seq-set {\n",
      "    seq {\n",
      "      id {\n",
      "        other {\n",
      "          accession \"NM_001126\",\n",
      "          version 2\n",
      "        },\n",
      "        gi 34577062\n",
      "      },\n",
      "      descr {\n",
      "        title \"Homo sapiens adenylosuccinate synthase (ADSS), mRNA\",\n",
      "        molinfo {\n",
      "          biomol mRNA,\n",
      "          completeness has-right\n",
      "        },\n",
      "        create-date std {\n",
      "          year 1999,\n",
      "          month 4,\n",
      "          day 1\n",
      "        }\n",
      "      },\n",
      "      inst {\n",
      "        repr raw,\n",
      "        mol rna,\n",
      "        length 2775,\n",
      "        seq-data ncbi2na 'A0AA6E976B5AAE9A5BE59452A5DF5E6A6B9E58A5A5E66A92D3AC\n",
      "557E26A7BA6889AA6A87A7A2AE9A569AA6AA6A96977A75F7D7793BA7A6964892F4BD9D1D765A59\n",
      "775F6A775D9B47A253A6F65885C569A4D757950698F9A5954A99A568A016AE1AEB9DAE64BAA618\n",
      "2902A0AEBA179E99286584DBB96794A8A030E7A5312FBEE8F7BA0CE3FD377C54BA0C3C3503B479\n",
      "3D3E80EBBAC3D3717A3EFE08248800EF400A00A1C829EA000A7CF3378489D33ECFE3FD34249E3A\n",
      "CD4A0412210810928003FAB104002A4FA54BF3DB50279DA2E874A3B985FBF787F8E9F7788AFC0B\n",
      "DC9C1431037331547FA03213E0AE0F1001D0ABCCE8023C050EB888E8BF3FDCCE295C4E85140803\n",
      "7EB20AE40E491CF233E3FEA1F15FFB05DF40FB1EFA2BBFB1EBFAB3945D00EFA20BB3A2FB809F31\n",
      "0722FACFAE5FD71224210E03E883CF1010AAC88BFAEC1C7A0A00823BA7AFA176FF9D0339D338D0\n",
      "E8FC79BE91F142FA33FE84EFC680D02FA2F9F10BC8EB80D3174CD52405082DF0302F82F4330877\n",
      "54A3A04484CD0390A9BF020717BC3910073BD8FCF82389F40F52F0BA3EBBEB035220DCE3D077FC\n",
      "38F94B0E42011D7E22A2A8021FDF033F4FCE17903D0830211E0B0BF825712FBF52DFF48E8E5C7B\n",
      "A23C1FE933D4BB49FDFC9E83E5034FEF9D79E774EB946FFFFF43BF2C32CC353BEFE33402C83C7F\n",
      "C3B2FFDF4F3ED3E6EF7C2FF1573C8EB0810F0E4BFE440CFFC4F78D3D2F7B4FB0DFEFBC8040E380\n",
      "132ABDEC07FEC39CE0F7BF03FEA7B73FDE78053900F89FEBAA7A8AABCECF4EA17F0FEC4811207C\n",
      "FDED2F3F0C4F803F2E03BD0220C8EFD500410DFCEF0032D3C0237BEC333AE8CFFDFC3F404F1778\n",
      "0EECDFF7FFCDF14F0FF0372E8FAFF4136E5E58CE5C4834DEC2ED00E0546FBC94C3FE3CE5FCFDD7\n",
      "F7E00000AEF3FE10F29304FBFEC8F37FC381CFF03BC0F2B947C0FCFF3C45383278F008140CFDCB\n",
      "0000000000'H,\n",
      "        hist {\n",
      "          replaces {\n",
      "            date std {\n",
      "              year 2003,\n",
      "              month 9,\n",
      "              day 11\n",
      "            },\n",
      "            ids {\n",
      "              gi 4557270\n",
      "            }\n",
      "          },\n",
      "          replaced-by {\n",
      "            date std {\n",
      "              year 2010,\n",
      "              month 11,\n",
      "              day 25\n",
      "            },\n",
      "            ids {\n",
      "              gi 312836839\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      },\n",
      "      annot {\n",
      "        {\n",
      "          data ftable {\n",
      "            {\n",
      "              data imp {\n",
      "                key \"polyA_signal\"\n",
      "              },\n",
      "              location int {\n",
      "                from 2731,\n",
      "                to 2736,\n",
      "                strand plus,\n",
      "                id gi 34577062\n",
      "              }\n",
      "            },\n",
      "            {\n",
      "              data imp {\n",
      "                key \"polyA_site\"\n",
      "              },\n",
      "              location pnt {\n",
      "                point 2756,\n",
      "                strand plus,\n",
      "                id gi 34577062\n",
      "              }\n",
      "            },\n",
      "            {\n",
      "              data gene {\n",
      "                locus \"ADSS\",\n",
      "                desc \"adenylosuccinate synthase\",\n",
      "                syn {\n",
      "                  \"ADEH\",\n",
      "                  \"MGC20404\"\n",
      "                }\n",
      "              },\n",
      "              location int {\n",
      "                from 0,\n",
      "                to 2774,\n",
      "                strand plus,\n",
      "                id gi 34577062\n",
      "              },\n",
      "              dbxref {\n",
      "                {\n",
      "                  db \"GeneID\",\n",
      "                  tag id 159\n",
      "                },\n",
      "                {\n",
      "                  db \"HGNC\",\n",
      "                  tag id 292\n",
      "                },\n",
      "                {\n",
      "                  db \"HPRD\",\n",
      "                  tag str \"00050\"\n",
      "                },\n",
      "                {\n",
      "                  db \"MIM\",\n",
      "                  tag id 103060\n",
      "                }\n",
      "              }\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    },\n",
      "    seq {\n",
      "      id {\n",
      "        other {\n",
      "          accession \"NP_001117\",\n",
      "          version 2\n",
      "        },\n",
      "        gi 34577063\n",
      "      },\n",
      "      descr {\n",
      "        title \"adenylosuccinate synthetase isozyme 2 [Homo sapiens]\",\n",
      "        molinfo {\n",
      "          biomol peptide\n",
      "        },\n",
      "        create-date std {\n",
      "          year 1999,\n",
      "          month 4,\n",
      "          day 1\n",
      "        }\n",
      "      },\n",
      "      inst {\n",
      "        repr raw,\n",
      "        mol aa,\n",
      "        length 456,\n",
      "        seq-data ncbieaa \"MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQ\n",
      "DADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIIS\n",
      "DRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPT\n",
      "LEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMP\n",
      "PQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALALTKLD\n",
      "ILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKW\n",
      "IGVGKSRESMIQLF\",\n",
      "        hist {\n",
      "          replaces {\n",
      "            date std {\n",
      "              year 2003,\n",
      "              month 9,\n",
      "              day 11\n",
      "            },\n",
      "            ids {\n",
      "              gi 4557271\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      },\n",
      "      annot {\n",
      "        {\n",
      "          data ftable {\n",
      "            {\n",
      "              data prot {\n",
      "                name {\n",
      "                  \"adenylosuccinate synthetase isozyme 2\",\n",
      "                  \"adenylosuccinate synthetase (Ade(-)H-complementing)\",\n",
      "                  \"adenylosuccinate synthetase, acidic isozyme\",\n",
      "                  \"IMP--aspartate ligase 2\",\n",
      "                  \"adSS 2\",\n",
      "                  \"AMPSase 2\",\n",
      "                  \"L-type adenylosuccinate synthetase\",\n",
      "                  \"adenylosuccinate synthetase, liver isozyme\"\n",
      "                },\n",
      "                ec {\n",
      "                  \"6.3.4.4\"\n",
      "                }\n",
      "              },\n",
      "              location int {\n",
      "                from 0,\n",
      "                to 455,\n",
      "                id gi 34577063\n",
      "              }\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    }\n",
      "  },\n",
      "  annot {\n",
      "    {\n",
      "      data ftable {\n",
      "        {\n",
      "          data cdregion {\n",
      "            frame one,\n",
      "            code {\n",
      "              id 1\n",
      "            }\n",
      "          },\n",
      "          product whole gi 34577063,\n",
      "          location int {\n",
      "            from 294,\n",
      "            to 1664,\n",
      "            strand plus,\n",
      "            id gi 34577062\n",
      "          },\n",
      "          dbxref {\n",
      "            {\n",
      "              db \"CCDS\",\n",
      "              tag str \"CCDS1624.1\"\n",
      "            }\n",
      "          }\n",
      "        }\n",
      "      }\n",
      "    }\n",
      "  }\n",
      "}\n",
      "\n",
      "\n"
     ]
    }
   ],
   "source": [
    "print(handle.read())"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 31,
   "id": "60fdd849",
   "metadata": {},
   "outputs": [],
   "source": [
    "#GI:number\n",
    "#database: nuccore\n",
    "handle=Entrez.efetch(db='nuccore',id='34577062',rettype='fasta')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 32,
   "id": "7ba3ed38",
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      ">NM_001126.2 Homo sapiens adenylosuccinate synthase (ADSS), mRNA\n",
      "GGAAGGGGCGTGGCCTCGGTCCGGGGTGGCGGCCGTTGCCGCCACCAGGGCCTCTTCCTGCGGGCGGTGC\n",
      "TGCCGAGGCCGGCCTGCGCGGGGCAGTCATGGTACCCCCTTGAGCGGGCTGTGGCGGAGAGCGGGGCGGG\n",
      "GACTGGCTGGAGGGTGGCGGCCCGGCGGGGCGGGGGCGGGGCCGGCCTCTGGCTCCTTCTTCCTCTGCAT\n",
      "GTGGCTGGCGGCCGCAGAGCAGTTCAGTTCGCTCACTCCTCGCCGGCCGCCTCTCCTTCGGGCTCTCCTC\n",
      "GCGTCACTGGAGCCATGGCGTTCGCCGAGACCTACCCGGCGGCATCCTCCCTGCCCAACGGCGATTGCGG\n",
      "CCGCCCCAGGGCGCGGCCCGGAGGAAACCGGGTGACGGTGGTGCTCGGTGCGCAGTGGGGCGACGAAGGC\n",
      "AAAGGGAAGGTGGTGGACCTGCTGGCGCAGGACGCCGACATCGTGTGCCGCTGCCAGGGAGGAAATAATG\n",
      "CTGGCCATACAGTTGTTGTGGATTCTGTGGAATATGATTTTCATCTCTTACCCAGTGGAATAATTAATCC\n",
      "AAATGTCACTGCATTCATTGGAAATGGTGTGGTAATTCATCTACCTGGATTGTTTGAAGAAGCAGAGAAA\n",
      "AATGTTCAAAAAGGAAAAGGACTAGAAGGCTGGGAAAAAAGGCTTATTATATCTGACAGAGCTCATATTG\n",
      "TATTTGATTTTCATCAAGCAGCTGATGGTATCCAGGAACAACAGAGACAAGAACAAGCAGGAAAAAATTT\n",
      "GGGTACAACAAAAAAGGGCATTGGCCCAGTTTATTCGTCCAAAGCTGCTCGGAGTGGACTCAGGATGTGC\n",
      "GACCTTGTTTCTGACTTTGATGGCTTCTCTGAGAGGTTTAAAGTTCTAGCTAACCAATACAAATCTATAT\n",
      "ACCCCACTTTGGAAATAGACATTGAAGGTGAATTACAAAAACTCAAGGGTTATATGGAAAAGATTAAACC\n",
      "AATGGTGAGAGATGGAGTTTATTTTCTATATGAGGCCCTACATGGACCACCAAAGAAAATCTTGGTAGAA\n",
      "GGTGCAAATGCAGCACTATTAGATATTGATTTTGGGACTTACCCTTTTGTAACCTCTTCAAATTGTACTG\n",
      "TTGGAGGTGTTTGTACTGGTTTGGGTATGCCACCTCAAAATGTTGGAGAAGTGTATGGAGTTGTGAAAGC\n",
      "TTATACAACTAGAGTTGGTATTGGTGCCTTTCCTACAGAGCAAGACAATGAAATTGGAGAATTATTACAA\n",
      "ACAAGGGGTAGAGAGTTTGGTGTAACTACTGGAAGGAAAAGAAGATGTGGCTGGTTGGACCTCGTTTTGC\n",
      "TCAAATATGCTCATATGATCAATGGATTTACTGCGTTGGCACTTACCAAGTTGGATATTTTGGACATGTT\n",
      "TACGGAAATCAAAGTTGGAGTTGCTTACAAGTTAGATGGTGAAATCATACCTCATATCCCAGCAAACCAA\n",
      "GAAGTCTTAAATAAAGTTGAAGTTCAATATAAGACTCTCCCAGGATGGAACACAGACATATCAAATGCAA\n",
      "GGGCGTTTAAAGAACTACCTGTTAATGCACAAAACTATGTTCGATTTATTGAAGATGAGCTTCAAATTCC\n",
      "AGTTAAGTGGATTGGTGTTGGTAAATCCAGAGAATCTATGATTCAACTCTTTTAATGATTGCCAGTAATG\n",
      "CAAGAAACACTCCTTGAGAGGGAGGGGAAAAGACTTTCTTAAATATTTCATTTATGACCTGCAAATTCAA\n",
      "GAATAAAGACACTGAAGTAAGTTTGAAGCCCTACAGTTGTTTCCAGTCTTTTCAGATGGATGCCTACTGT\n",
      "GGAGATTAACTTTGGCATATTCCAGTGTCAGCTTTCTTTAGCTGGAATTGCCAAATCATTTGTTGCTCCT\n",
      "GCTGCTCTCATGGTGCCACGTTTTTTTTTTCAATGTTTAGTAATAGTATAATCCATGTTGTTTGATATCA\n",
      "AAAGTAGAATTACTTTTAATGTAGTTTTTCTTCATTATTGTCATTGCGTGTTCTTAAGTTTTACCCCTAT\n",
      "TAGATGGTAAGAACAATTAATGCAGTTTTGCACAAATATTTTTACATTCTGATCATTCAGTTCTGTCATT\n",
      "GTAATCTTTGTTGTTAGAAACAAATGATGAAAACATAGGGGTTCTGTAAACTTTTGTAATGCTATGAATT\n",
      "CTGTTTAAATTTTGGGCTGTCTATTTTCTGCTGAAACCATGCAAAATTGAGCTTTGGTGGGGCTGGGAGG\n",
      "GGGTTATGTATTCATGGGACCTTTAATTTGTACAGAACACAGAACTTATTTCTGTCAGTTATTTAATACA\n",
      "TTGAAAATTTAGTGAAATGTTCAAAGAGAATAGATGTTTCCCAAAACAACAATCTTTATGTTAAAAATAG\n",
      "TCATTAAAAGATCTGTTGTAATATATGGTGGATATTTTTCTTTAATTTCAAACATTACCTCTGAAATGTG\n",
      "TATCTTTTCTTTTTTATCTTACCATTAATTTTAAATCTAGTGGATTGGTTTTCAACATCGTGCCTGCCGA\n",
      "TATGCCTACAGAATCATCTGTAAGTGTCAAAATGAACCCACGTTGTTAGCCATAATTTTGATTATGCCTT\n",
      "TATTTCTCCTTTCTTGAAAAAAAAAAGGTGTTATTTTGACAATTAGGCATAACATTGTTTTGTAGATTAT\n",
      "CTTTTAATGAACTATTTTAAATGTTAAATTAGGTGCCACTTAAATTTATTTTATTACACCATGAATAGCT\n",
      "GATTAAAAGAACCAAATATTTCTAGTAAAAAAAAAAAAAAAAAAA\n",
      "\n",
      "\n"
     ]
    }
   ],
   "source": [
    "print(handle.read())"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 33,
   "id": "da947d17",
   "metadata": {},
   "outputs": [],
   "source": [
    "#db:nuc\n",
    "#ID: accession number\n",
    "#out format: ganbank\n",
    "#displany format: text\n",
    "handle=Entrez.efetch(db='nucleotide',id='NM_001126.2',rettype='gb',retmode='text')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 34,
   "id": "e0bc943f",
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "LOCUS       NM_001126               2775 bp    mRNA    linear   PRI 10-OCT-2010\n",
      "DEFINITION  Homo sapiens adenylosuccinate synthase (ADSS), mRNA.\n",
      "ACCESSION   NM_001126\n",
      "VERSION     NM_001126.2\n",
      "KEYWORDS    RefSeq.\n",
      "SOURCE      Homo sapiens (human)\n",
      "  ORGANISM  Homo sapiens\n",
      "            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;\n",
      "            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;\n",
      "            Catarrhini; Hominidae; Homo.\n",
      "REFERENCE   1  (bases 1 to 2775)\n",
      "  AUTHORS   Sivendran,S. and Colman,R.F.\n",
      "  TITLE     Effect of a new non-cleavable substrate analog on wild-type and\n",
      "            serine mutants in the signature sequence of adenylosuccinate lyase\n",
      "            of Bacillus subtilis and Homo sapiens\n",
      "  JOURNAL   Protein Sci. 17 (7), 1162-1174 (2008)\n",
      "   PUBMED   18469177\n",
      "  REMARK    GeneRIF: Kinetic data reveal that human Ser(289) and B. subtilis\n",
      "            Ser(262) and Ser(263) are essential for catalysis, while the\n",
      "            ability of these Ser mutants to bind APBADP suggests that they do\n",
      "            not contribute to substrate affinity\n",
      "REFERENCE   2  (bases 1 to 2775)\n",
      "  AUTHORS   Zhang,F., Xu,Y., Liu,P., Fan,H., Huang,X., Sun,G., Song,Y. and\n",
      "            Sham,P.C.\n",
      "  TITLE     Association analyses of the interaction between the ADSS and ATM\n",
      "            genes with schizophrenia in a Chinese population\n",
      "  JOURNAL   BMC Med. Genet. 9, 119 (2008)\n",
      "   PUBMED   19115993\n",
      "  REMARK    GeneRIF: These findings suggest that the combined effects of the\n",
      "            polymorphisms in the ADSS and ATM genes may confer susceptibility\n",
      "            to the development of schizophrenia in a Chinese population\n",
      "            GeneRIF: Observational study of gene-disease association and\n",
      "            gene-gene interaction. (HuGE Navigator)\n",
      "            Publication Status: Online-Only\n",
      "REFERENCE   3  (bases 1 to 2775)\n",
      "  AUTHORS   Zhang,F., Sham,P.C., Fan,H., Xu,Y., Huang,X., So,H., Song,Y. and\n",
      "            Liu,P.\n",
      "  TITLE     An association study of ADSS gene polymorphisms with schizophrenia\n",
      "  JOURNAL   Behav Brain Funct 4, 39 (2008)\n",
      "   PUBMED   18721483\n",
      "  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE\n",
      "            Navigator)\n",
      "            Publication Status: Online-Only\n",
      "REFERENCE   4  (bases 1 to 2775)\n",
      "  AUTHORS   Sun,H., Li,N., Wang,X., Chen,T., Shi,L., Zhang,L., Wang,J., Wan,T.\n",
      "            and Cao,X.\n",
      "  TITLE     Molecular cloning and characterization of a novel muscle\n",
      "            adenylosuccinate synthetase, AdSSL1, from human bone marrow stromal\n",
      "            cells\n",
      "  JOURNAL   Mol. Cell. Biochem. 269 (1-2), 85-94 (2005)\n",
      "   PUBMED   15786719\n",
      "REFERENCE   5  (bases 1 to 2775)\n",
      "  AUTHORS   Stepinski,J., Pawelczyk,T., Bizon,D. and Angielski,S.\n",
      "  TITLE     Purine nucleotide cycle in rat renal cortex and medulla under\n",
      "            conditions that mimic normal and low oxygen supply\n",
      "  JOURNAL   Kidney Int. 50 (4), 1195-1201 (1996)\n",
      "   PUBMED   8887278\n",
      "REFERENCE   6  (bases 1 to 2775)\n",
      "  AUTHORS   Powell,S.M., Zalkin,H. and Dixon,J.E.\n",
      "  TITLE     Cloning and characterization of the cDNA encoding human\n",
      "            adenylosuccinate synthetase\n",
      "  JOURNAL   FEBS Lett. 303 (1), 4-10 (1992)\n",
      "   PUBMED   1592113\n",
      "REFERENCE   7  (bases 1 to 2775)\n",
      "  AUTHORS   Zalkin,H. and Dixon,J.E.\n",
      "  TITLE     De novo purine nucleotide biosynthesis\n",
      "  JOURNAL   Prog. Nucleic Acid Res. Mol. Biol. 42, 259-287 (1992)\n",
      "   PUBMED   1574589\n",
      "  REMARK    Review article\n",
      "REFERENCE   8  (bases 1 to 2775)\n",
      "  AUTHORS   Lai,L.W., Hart,I.M. and Patterson,D.\n",
      "  TITLE     A gene correcting the defect in the CHO mutant Ade -H, deficient in\n",
      "            a branch point enzyme (adenylosuccinate synthetase) of de novo\n",
      "            purine biosynthesis, is located on the long arm of chromosome 1\n",
      "  JOURNAL   Genomics 9 (2), 322-328 (1991)\n",
      "   PUBMED   2004783\n",
      "REFERENCE   9  (bases 1 to 2775)\n",
      "  AUTHORS   Ogawa,H., Shiraki,H., Matsuda,Y. and Nakagawa,H.\n",
      "  TITLE     Interaction of adenylosuccinate synthetase with F-actin\n",
      "  JOURNAL   Eur. J. Biochem. 85 (2), 331-337 (1978)\n",
      "   PUBMED   648524\n",
      "REFERENCE   10 (bases 1 to 2775)\n",
      "  AUTHORS   Van der Weyden,M.B. and Kelly,W.N.\n",
      "  TITLE     Human adenylosuccinate synthetase. Partial purification, kinetic\n",
      "            and regulatory properties of the enzyme from placenta\n",
      "  JOURNAL   J. Biol. Chem. 249 (22), 7282-7289 (1974)\n",
      "   PUBMED   4436310\n",
      "COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The\n",
      "            reference sequence was derived from BC012356.1 and BG700800.1.\n",
      "            [WARNING] On Nov 25, 2010 this sequence was replaced by\n",
      "            NM_001126.3.\n",
      "            On Sep 11, 2003 this sequence version replaced NM_001126.1.\n",
      "            \n",
      "            Summary: Adenylosuccinate synthetase catalyzes the first committed\n",
      "            step in the conversion of IMP to AMP [provided by RefSeq].\n",
      "            COMPLETENESS: complete on the 3' end.\n",
      "FEATURES             Location/Qualifiers\n",
      "     source          1..2775\n",
      "                     /organism=\"Homo sapiens\"\n",
      "                     /mol_type=\"mRNA\"\n",
      "                     /db_xref=\"taxon:9606\"\n",
      "                     /chromosome=\"1\"\n",
      "                     /map=\"1cen-q12\"\n",
      "     gene            1..2775\n",
      "                     /gene=\"ADSS\"\n",
      "                     /gene_synonym=\"ADEH; MGC20404\"\n",
      "                     /note=\"adenylosuccinate synthase\"\n",
      "                     /db_xref=\"GeneID:159\"\n",
      "                     /db_xref=\"HGNC:HGNC:292\"\n",
      "                     /db_xref=\"HPRD:00050\"\n",
      "                     /db_xref=\"MIM:103060\"\n",
      "     CDS             295..1665\n",
      "                     /gene=\"ADSS\"\n",
      "                     /gene_synonym=\"ADEH; MGC20404\"\n",
      "                     /EC_number=\"6.3.4.4\"\n",
      "                     /note=\"adenylosuccinate synthetase\n",
      "                     (Ade(-)H-complementing); adenylosuccinate synthetase,\n",
      "                     acidic isozyme; IMP--aspartate ligase 2; adSS 2; AMPSase\n",
      "                     2; L-type adenylosuccinate synthetase; adenylosuccinate\n",
      "                     synthetase, liver isozyme\"\n",
      "                     /codon_start=1\n",
      "                     /product=\"adenylosuccinate synthetase isozyme 2\"\n",
      "                     /protein_id=\"NP_001117.2\"\n",
      "                     /db_xref=\"CCDS:CCDS1624.1\"\n",
      "                     /db_xref=\"GeneID:159\"\n",
      "                     /db_xref=\"HGNC:HGNC:292\"\n",
      "                     /db_xref=\"HPRD:00050\"\n",
      "                     /db_xref=\"MIM:103060\"\n",
      "                     /translation=\"MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKG\n",
      "                     KVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIH\n",
      "                     LPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLG\n",
      "                     TTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQ\n",
      "                     KLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTV\n",
      "                     GGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGR\n",
      "                     KRRCGWLDLVLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQ\n",
      "                     EVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRE\n",
      "                     SMIQLF\"\n",
      "     regulatory      2732..2737\n",
      "                     /regulatory_class=\"polyA_signal_sequence\"\n",
      "                     /gene=\"ADSS\"\n",
      "                     /gene_synonym=\"ADEH; MGC20404\"\n",
      "     polyA_site      2757\n",
      "                     /gene=\"ADSS\"\n",
      "                     /gene_synonym=\"ADEH; MGC20404\"\n",
      "ORIGIN      \n",
      "        1 ggaaggggcg tggcctcggt ccggggtggc ggccgttgcc gccaccaggg cctcttcctg\n",
      "       61 cgggcggtgc tgccgaggcc ggcctgcgcg gggcagtcat ggtaccccct tgagcgggct\n",
      "      121 gtggcggaga gcggggcggg gactggctgg agggtggcgg cccggcgggg cgggggcggg\n",
      "      181 gccggcctct ggctccttct tcctctgcat gtggctggcg gccgcagagc agttcagttc\n",
      "      241 gctcactcct cgccggccgc ctctccttcg ggctctcctc gcgtcactgg agccatggcg\n",
      "      301 ttcgccgaga cctacccggc ggcatcctcc ctgcccaacg gcgattgcgg ccgccccagg\n",
      "      361 gcgcggcccg gaggaaaccg ggtgacggtg gtgctcggtg cgcagtgggg cgacgaaggc\n",
      "      421 aaagggaagg tggtggacct gctggcgcag gacgccgaca tcgtgtgccg ctgccaggga\n",
      "      481 ggaaataatg ctggccatac agttgttgtg gattctgtgg aatatgattt tcatctctta\n",
      "      541 cccagtggaa taattaatcc aaatgtcact gcattcattg gaaatggtgt ggtaattcat\n",
      "      601 ctacctggat tgtttgaaga agcagagaaa aatgttcaaa aaggaaaagg actagaaggc\n",
      "      661 tgggaaaaaa ggcttattat atctgacaga gctcatattg tatttgattt tcatcaagca\n",
      "      721 gctgatggta tccaggaaca acagagacaa gaacaagcag gaaaaaattt gggtacaaca\n",
      "      781 aaaaagggca ttggcccagt ttattcgtcc aaagctgctc ggagtggact caggatgtgc\n",
      "      841 gaccttgttt ctgactttga tggcttctct gagaggttta aagttctagc taaccaatac\n",
      "      901 aaatctatat accccacttt ggaaatagac attgaaggtg aattacaaaa actcaagggt\n",
      "      961 tatatggaaa agattaaacc aatggtgaga gatggagttt attttctata tgaggcccta\n",
      "     1021 catggaccac caaagaaaat cttggtagaa ggtgcaaatg cagcactatt agatattgat\n",
      "     1081 tttgggactt acccttttgt aacctcttca aattgtactg ttggaggtgt ttgtactggt\n",
      "     1141 ttgggtatgc cacctcaaaa tgttggagaa gtgtatggag ttgtgaaagc ttatacaact\n",
      "     1201 agagttggta ttggtgcctt tcctacagag caagacaatg aaattggaga attattacaa\n",
      "     1261 acaaggggta gagagtttgg tgtaactact ggaaggaaaa gaagatgtgg ctggttggac\n",
      "     1321 ctcgttttgc tcaaatatgc tcatatgatc aatggattta ctgcgttggc acttaccaag\n",
      "     1381 ttggatattt tggacatgtt tacggaaatc aaagttggag ttgcttacaa gttagatggt\n",
      "     1441 gaaatcatac ctcatatccc agcaaaccaa gaagtcttaa ataaagttga agttcaatat\n",
      "     1501 aagactctcc caggatggaa cacagacata tcaaatgcaa gggcgtttaa agaactacct\n",
      "     1561 gttaatgcac aaaactatgt tcgatttatt gaagatgagc ttcaaattcc agttaagtgg\n",
      "     1621 attggtgttg gtaaatccag agaatctatg attcaactct tttaatgatt gccagtaatg\n",
      "     1681 caagaaacac tccttgagag ggaggggaaa agactttctt aaatatttca tttatgacct\n",
      "     1741 gcaaattcaa gaataaagac actgaagtaa gtttgaagcc ctacagttgt ttccagtctt\n",
      "     1801 ttcagatgga tgcctactgt ggagattaac tttggcatat tccagtgtca gctttcttta\n",
      "     1861 gctggaattg ccaaatcatt tgttgctcct gctgctctca tggtgccacg tttttttttt\n",
      "     1921 caatgtttag taatagtata atccatgttg tttgatatca aaagtagaat tacttttaat\n",
      "     1981 gtagtttttc ttcattattg tcattgcgtg ttcttaagtt ttacccctat tagatggtaa\n",
      "     2041 gaacaattaa tgcagttttg cacaaatatt tttacattct gatcattcag ttctgtcatt\n",
      "     2101 gtaatctttg ttgttagaaa caaatgatga aaacataggg gttctgtaaa cttttgtaat\n",
      "     2161 gctatgaatt ctgtttaaat tttgggctgt ctattttctg ctgaaaccat gcaaaattga\n",
      "     2221 gctttggtgg ggctgggagg gggttatgta ttcatgggac ctttaatttg tacagaacac\n",
      "     2281 agaacttatt tctgtcagtt atttaataca ttgaaaattt agtgaaatgt tcaaagagaa\n",
      "     2341 tagatgtttc ccaaaacaac aatctttatg ttaaaaatag tcattaaaag atctgttgta\n",
      "     2401 atatatggtg gatatttttc tttaatttca aacattacct ctgaaatgtg tatcttttct\n",
      "     2461 tttttatctt accattaatt ttaaatctag tggattggtt ttcaacatcg tgcctgccga\n",
      "     2521 tatgcctaca gaatcatctg taagtgtcaa aatgaaccca cgttgttagc cataattttg\n",
      "     2581 attatgcctt tatttctcct ttcttgaaaa aaaaaaggtg ttattttgac aattaggcat\n",
      "     2641 aacattgttt tgtagattat cttttaatga actattttaa atgttaaatt aggtgccact\n",
      "     2701 taaatttatt ttattacacc atgaatagct gattaaaaga accaaatatt tctagtaaaa\n",
      "     2761 aaaaaaaaaa aaaaa\n",
      "//\n",
      "\n",
      "\n"
     ]
    }
   ],
   "source": [
    "print(handle.read())"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 44,
   "id": "e48b87c2",
   "metadata": {},
   "outputs": [],
   "source": [
    "handle=Entrez.efetch(db='nucleotide',id='NM_001126.2',rettype='fasta',retmode='text')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 45,
   "id": "6e9ead5e",
   "metadata": {},
   "outputs": [],
   "source": [
    "record=SeqIO.read(handle,'fasta')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 46,
   "id": "61550a37",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "'NM_001126.2'"
      ]
     },
     "execution_count": 46,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "record.id"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 48,
   "id": "d0c8bdcd",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "'NM_001126.2 Homo sapiens adenylosuccinate synthase (ADSS), mRNA'"
      ]
     },
     "execution_count": 48,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "record.description"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 49,
   "id": "822e2add",
   "metadata": {},
   "outputs": [],
   "source": [
    "seq=record.seq"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 52,
   "id": "aec5e3c1",
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "GGAA\n"
     ]
    },
    {
     "data": {
      "text/plain": [
       "2775"
      ]
     },
     "execution_count": 52,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "print(seq[0:4])\n",
    "len(seq)\n",
    "#print(seq)"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 53,
   "id": "6bd4abf8",
   "metadata": {},
   "outputs": [],
   "source": [
    "handle=Entrez.efetch(db='nucleotide',id='NM_001126.2',rettype='gb',retmode='text')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 54,
   "id": "32a6091a",
   "metadata": {},
   "outputs": [],
   "source": [
    "record=SeqIO.read(handle,'gb')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 56,
   "id": "ba271fe9",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "'NM_001126.2'"
      ]
     },
     "execution_count": 56,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "record.id"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 57,
   "id": "ed105633",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "'Homo sapiens adenylosuccinate synthase (ADSS), mRNA'"
      ]
     },
     "execution_count": 57,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "record.description"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 59,
   "id": "cdcbb358",
   "metadata": {},
   "outputs": [],
   "source": [
    "features=record.features"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 61,
   "id": "4915fb07",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "5"
      ]
     },
     "execution_count": 61,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "len(features)"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 62,
   "id": "ff3d018d",
   "metadata": {},
   "outputs": [
    {
     "name": "stdout",
     "output_type": "stream",
     "text": [
      "[SeqFeature(FeatureLocation(ExactPosition(0), ExactPosition(2775), strand=1), type='source'), SeqFeature(FeatureLocation(ExactPosition(0), ExactPosition(2775), strand=1), type='gene'), SeqFeature(FeatureLocation(ExactPosition(294), ExactPosition(1665), strand=1), type='CDS'), SeqFeature(FeatureLocation(ExactPosition(2731), ExactPosition(2737), strand=1), type='regulatory'), SeqFeature(FeatureLocation(ExactPosition(2756), ExactPosition(2757), strand=1), type='polyA_site')]\n"
     ]
    }
   ],
   "source": [
    "print(features)"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 71,
   "id": "b02276e2",
   "metadata": {},
   "outputs": [],
   "source": [
    "#####Multiple seq\n",
    "handle=Entrez.efetch(db='nuccore',id='34577062,186972394',rettype='fasta')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 72,
   "id": "4f6d981c",
   "metadata": {},
   "outputs": [],
   "source": [
    "records=SeqIO.parse(handle,'fasta')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 73,
   "id": "8502f00a",
   "metadata": {},
   "outputs": [],
   "source": [
    "records=[i for i in records]"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 75,
   "id": "646ff002",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "2"
      ]
     },
     "execution_count": 75,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "len(records)"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 76,
   "id": "0a3cc9f9",
   "metadata": {},
   "outputs": [],
   "source": [
    "f_records=records[0]\n",
    "sec_records=records[1]"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 77,
   "id": "febce03e",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "'NM_001126.2'"
      ]
     },
     "execution_count": 77,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "f_records.id"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 78,
   "id": "bef62c27",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "'EU490707.1'"
      ]
     },
     "execution_count": 78,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "sec_records.id"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": null,
   "id": "db11d175",
   "metadata": {},
   "outputs": [],
   "source": [
    "##Download and save genbank file"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 89,
   "id": "14509ba3",
   "metadata": {},
   "outputs": [],
   "source": [
    "handle=Entrez.efetch(db='nucleotide',id='34577062',rettype='gb')\n",
    "records=SeqIO.read(handle,'gb')\n",
    "outputname='/home/mmk6053/Manoj_data/python_prac/ADDS.gb'"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 90,
   "id": "08777412",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "1"
      ]
     },
     "execution_count": 90,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "SeqIO.write(records,outputname,'gb')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 97,
   "id": "41cb22d8",
   "metadata": {},
   "outputs": [],
   "source": [
    "#download fasta files\n",
    "handle=Entrez.efetch(db='nucleotide',id='34577062',rettype='fasta')\n",
    "records=SeqIO.read(handle,'fasta')\n",
    "outputname='/home/mmk6053/Manoj_data/python_prac/ADDS.fasta'"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 98,
   "id": "739e1ee3",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "1"
      ]
     },
     "execution_count": 98,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "SeqIO.write(records,outputname,'fasta')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 99,
   "id": "a4fda4ef",
   "metadata": {},
   "outputs": [],
   "source": [
    "##Multiple files download"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 100,
   "id": "f9ff23db",
   "metadata": {},
   "outputs": [],
   "source": [
    "#download fasta files\n",
    "handle=Entrez.efetch(db='nucleotide',id='34577062,186972394',rettype='fasta')\n",
    "records=SeqIO.parse(handle,'fasta')\n",
    "outputname='/home/mmk6053/Manoj_data/python_prac/multiple.fasta'"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": 101,
   "id": "d90d1ae5",
   "metadata": {},
   "outputs": [
    {
     "data": {
      "text/plain": [
       "2"
      ]
     },
     "execution_count": 101,
     "metadata": {},
     "output_type": "execute_result"
    }
   ],
   "source": [
    "SeqIO.write(records,outputname,'fasta')"
   ]
  },
  {
   "cell_type": "code",
   "execution_count": null,
   "id": "7e6d71d9",
   "metadata": {},
   "outputs": [],
   "source": []
  }
 ],
 "metadata": {
  "kernelspec": {
   "display_name": "Python 3 (ipykernel)",
   "language": "python",
   "name": "python3"
  },
  "language_info": {
   "codemirror_mode": {
    "name": "ipython",
    "version": 3
   },
   "file_extension": ".py",
   "mimetype": "text/x-python",
   "name": "python",
   "nbconvert_exporter": "python",
   "pygments_lexer": "ipython3",
   "version": "3.9.7"
  }
 },
 "nbformat": 4,
 "nbformat_minor": 5
}