AIRR-iReceptorMapping.txt

ir_id	ir_full	ir_short	ir_curator	ir_repository	ir_repository_type	ir_repository_is_array	ir_repository_indexed	vquest_file	vquest	vquest_calculate	igblast	mixcr	mixcr_v3	adaptive	10x_contig	ir_general	akc_class	akc_field	akc_form	akc_type	akc_is_array	akc_convert	airr	airr_name	airr_spec	airr_required	ir_class	ir_subclass	ir_adc_api_query	ir_adc_api_response	airr_is_array	airr_type	airr_description	airr_title	airr_nullable	airr_adc-query-support	airr_identifier	airr_example	airr_miairr	airr_set	airr_subset	airr_format	airr_deprecated	airr_deprecated-description	airr_deprecated-replaced-by	airr_enum	service_name	projection	ir_api_input	ir_api_input_type	ir_api_output	ir_api_output_type	airr_tsv	irplus_stats_api_query	irplus_stats_api_response	irplus_stats_type
repertoire_id	Repertoire ID	Repertoire ID	repertoire_id	repertoire_id	string	FALSE	FALSE																repertoire_id		TRUE	FALSE	Repertoire	Repertoire	repertoire_id	repertoire_id	FALSE	string	"Identifier for the repertoire object. This identifier should be globally unique so that repertoires from multiple studies can be combined together without conflict. The repertoire_id is used to link other AIRR data to a Repertoire. Specifically, the Rearrangements Schema includes repertoire_id for referencing the specific Repertoire for that Rearrangement."	Repertoire ID	TRUE	TRUE	TRUE										ir_project_sample_id		repertoire_id	string	repertoire_id	string		repertioire_id	repertoire_id	string
repertoire_name	Repertoire Name	Repertoire Name	repertoire_name	repertoire_name	string	FALSE	FALSE																repertoire_name	Repertoire name	TRUE	FALSE	Repertoire	Repertoire	repertoire_name	repertoire_name	FALSE	string	Short generic display name for the repertoire	Repertoire name	TRUE	TRUE											repertoire_name		repertoire_name	string	repertoire_name	string				
repertoire_description	Repertoire Description	Repertoire Description	repertoire_description	repertoire_description	string	FALSE	FALSE																repertoire_description	Repertoire description	TRUE	FALSE	Repertoire	Repertoire	repertoire_description	repertoire_description	FALSE	string	Generic repertoire description	Repertoire description	TRUE	TRUE											repertoire_description		repertoire_description	string	repertoire_description	string				
study_id	Study ID	Study ID	study_id	study_id	string	FALSE	FALSE										Investigation	archival_id	line	uriorcurie			study_id	Study ID	TRUE	TRUE	Repertoire	Study	study.study_id	study.study_id	FALSE	string	Unique ID assigned by study registry such as one of the International Nucleotide Sequence Database Collaboration (INSDC) repositories.	Study ID	TRUE	TRUE	TRUE	PRJNA001	TRUE	1	study						study_id		study_id	string	study_id	string				
study_title	Study title	Study title	study_title	study_title	string	FALSE	FALSE										Investigation	name	line	string			study_title	Study title	TRUE	TRUE	Repertoire	Study	study.study_title	study.study_title	FALSE	string	Descriptive study title	Study title	TRUE	TRUE		Effects of sun light exposure of the Treg repertoire	TRUE	1	study						study_title		study_title	string	study_title	string				
study_type	Study type	Study type	study_type	study_type	string	FALSE	FALSE										Investigation	study_type	Enum	StudyType		"Ontology, Enum"	study_type	Study type	TRUE	TRUE	Repertoire	Study	study.study_type.label	study.study_type.label	FALSE	string	Type of study design	Study type	TRUE	TRUE		"NCIT:C15197, Case-Control Study"	TRUE	1	study	ontology					study_type		study_type	string	study_type	string				
study_type_id	Study type (Ontology ID)	Study type (Ontology ID)	study_type_id	study_type_id	string	FALSE	FALSE																study_type_id	Study type (Ontology ID)	TRUE	TRUE	Repertoire	Study	study.study_type.id	study.study_type.id	FALSE	string	Type of study design (Ontology ID)	Study type (Ontology ID)	TRUE	TRUE		"NCIT:C15197, Case-Control Study"	TRUE	1	study	ontology					study_type_id		study_type_id	string	study_type_id	string				
study_description	Study Description	Study Description	study_description	study_description	string	FALSE	FALSE										Investigation	description	line	string			study_description	Study description	TRUE	FALSE	Repertoire	Study	study.study_description	study.study_description	FALSE	string	Generic study description	Study description	TRUE	TRUE		Longer description									study_description		study_description	string	study_description	string				
inclusion_exclusion_criteria	Study inclusion/exclusion criteria	Inclusion criteria	inclusion_exclusion_criteria	inclusion_exclusion_criteria	string	FALSE	FALSE										StudyArm	inclusion_criteria		string		Parse	inclusion_exclusion_criteria	Study inclusion/exclusion criteria	TRUE	TRUE	Repertoire	Study	study.inclusion_exclusion_criteria	study.inclusion_exclusion_criteria	FALSE	string	List of criteria for inclusion/exclusion for the study	Study inclusion/exclusion criteria	TRUE	TRUE		Include: Clinical P. falciparum infection; Exclude: Seropositive for HIV	TRUE	1	study						inclusion_exclusion_criteria		inclusion_exclusion_criteria	string	inclusion_exclusion_criteria	string				
grants	Grant funding agency	Funding	grants	grants	string	FALSE	FALSE																grants	Grant funding agency	TRUE	TRUE	Repertoire	Study	study.grants	study.grants	FALSE	string	Funding agencies and grant numbers	Grant funding agency	TRUE	TRUE		"NIH, award number R01GM987654"	TRUE	1	study						grants		grants	string	grants	string				
study_contact	Contact information (study)	Contact (collection)	study_contact	study_contact	string	FALSE	FALSE																study_contact	Contact information (study)	TRUE	FALSE	Repertoire	Study	study.study_contact	study.study_contact	FALSE	string	Full contact information of the contact persons for this study This should include an e-mail address and a persistent identifier such as an ORCID ID.	Contact information (study)	TRUE	TRUE		"Dr. P. Stibbons, p.stibbons@unseenu.edu, https://orcid.org/0000-0002-1825-0097"									study_contact		study_contact	string	study_contact	string				
collected_by	Contact information (data collection)	Contact (collection)	collected_by	collected_by	string	FALSE	FALSE																collected_by	Contact information (data collection)	TRUE	TRUE	Repertoire	Study	study.collected_by	study.collected_by	FALSE	string	"Full contact information of the data collector, i.e. the person who is legally responsible for data collection and release. This should include an e-mail address and a persistent identifier such as an ORCID ID."	Contact information (data collection)	TRUE	TRUE		"Dr. P. Stibbons, p.stibbons@unseenu.edu, https://orcid.org/0000-0002-1825-0097"	TRUE	1	study						collected_by		collected_by	string	collected_by	string				
lab_name	Lab name	Lab name	lab_name	lab_name	string	FALSE	FALSE																lab_name	Lab name	TRUE	TRUE	Repertoire	Study	study.lab_name	study.lab_name	FALSE	string	Department of data collector	Lab name	TRUE	TRUE		Department for Planar Immunology	TRUE	1	study						lab_name		lab_name	string	lab_name	string				
lab_address	Lab address	Lab address	lab_address	lab_address	string	FALSE	FALSE																lab_address	Lab address	TRUE	TRUE	Repertoire	Study	study.lab_address	study.lab_address	FALSE	string	Institution and institutional address of data collector	Lab address	TRUE	TRUE		"School of Medicine, Unseen University, Ankh-Morpork, Disk World"	TRUE	1	study						lab_address		lab_address	string	lab_address	string				
submitted_by	Contact information (data deposition)	Contact (deposition)	submitted_by	submitted_by	string	FALSE	FALSE																submitted_by	Contact information (data deposition)	TRUE	TRUE	Repertoire	Study	study.submitted_by	study.submitted_by	FALSE	string	"Full contact information of the data depositor, i.e., the person submitting the data to a repository. This should include an e-mail address and a persistent identifier such as an ORCID ID. This is supposed to be a short-lived and technical role until the submission is relased."	Contact information (data deposition)	TRUE	TRUE		"Adrian Turnipseed, a.turnipseed@unseenu.edu, https://orcid.org/0000-0002-1825-0097"	TRUE	1	study						submitted_by		submitted_by	string	submitted_by	string				
pub_ids	Relevant publications	Publications	pub_ids	pub_ids	string	FALSE	FALSE										Reference	sources		uriorcurie	TRUE	"String, Array"	pub_ids	Relevant publications	TRUE	TRUE	Repertoire	Study	study.pub_ids	study.pub_ids	FALSE	string	"Publications describing the rationale and/or outcome of the study. Where ever possible, a persistent identifier should be used such as a DOI or a Pubmed ID"	Relevant publications	TRUE	TRUE		PMID:85642	TRUE	1	study						pub_ids		pub_ids	string	pub_ids	string				
keywords_study	Keywords for study	Study keywords	keywords_study	keywords_study	string	TRUE	FALSE																keywords_study	Keywords for study	TRUE	TRUE	Repertoire	Study	study.keywords_study	study.keywords_study	TRUE	string	"Keywords describing properties of one or more data sets in a study. ""contains_schema"" keywords indicate that the study contains data objects from the AIRR Schema of that type (Rearrangement, Clone, Cell, Receptor) while the other keywords indicate that the study design considers the type of data indicated (e.g. it is possible to have a study that ""contains_paired_chain"" but does not ""contains_schema_cell"")."	Keywords for study	TRUE	TRUE		"['contains_ig', 'contains_schema_rearrangement', 'contains_schema_clone', 'contains_schema_cell']"	TRUE	1	study	controlled_vocabulary					keywords_study		keywords_study	string	keywords_study	string				
adc_publish_date	ADC Publish Date	ADC Publish Date		adc_publish_date	string	FALSE	FALSE										Investigation	release_date		datetime			adc_publish_date	ADC Publish Date	TRUE	FALSE	Repertoire	Study	study.adc_publish_date	study.adc_publish_date	FALSE	string	Date the study was first published in the AIRR Data Commons.	ADC Publish Date	TRUE	TRUE		44229				date-time					adc_publish_date		adc_publish_date	string	adc_publish_date	string				
adc_update_date	ADC Update Date	ADC Update Date		adc_update_date	string	FALSE	FALSE										Investigation	update_date		datetime			adc_update_date	ADC Update Date	TRUE	FALSE	Repertoire	Study	study.adc_update_date	study.adc_update_date	FALSE	string	Date the study data was updated in the AIRR Data Commons.	ADC Update Date	TRUE	TRUE		44229				date-time					adc_update_date		adc_update_date	string	adc_update_date	string				
subject_id	Subject ID	Subject ID	subject_id	subject_id	string	FALSE	FALSE										Participant	name	line	string			subject_id	Subject ID	TRUE	TRUE	Repertoire	Subject	subject.subject_id	subject.subject_id	FALSE	string	"Subject ID assigned by submitter, unique within study. If possible, a persistent subject ID linked to an INSDC or similar repository study should be used."	Subject ID	TRUE	TRUE	TRUE	SUB856413	TRUE	1	subject						subject_id		subject_id	string	subject_id	string				
synthetic	Synthetic library	Synthetic library	synthetic	synthetic	boolean	FALSE	FALSE																synthetic	Synthetic library	TRUE	TRUE	Repertoire	Subject	subject.synthetic	subject.synthetic	FALSE	boolean	TRUE for libraries in which the diversity has been synthetically generated (e.g. phage display)	Synthetic library	FALSE	TRUE			TRUE	1	subject						synthetic		synthetic	boolean	synthetic	boolean				
organism	Organism	Organism	species	species	string	FALSE	FALSE										Participant	species	enum	Species		"Ontology, Enum"	species	Organism	TRUE	TRUE	Repertoire	Subject	subject.species.label	subject.species.label	FALSE	string	Binomial designation of subject's species	Organism	FALSE	TRUE		"NCBITAXON:9606, Homo sapiens"	TRUE	1	subject	ontology					organism		organism	string	organism	string				
organism_id	Organism (Ontology ID)	Organism (Ontology ID)	species_id	species_id	string	FALSE	FALSE																species_id	Organism (Ontology ID)	TRUE	TRUE	Repertoire	Subject	subject.species.id	subject.species.id	FALSE	string	Binomial designation of subject's species (Ontology ID)	Organism (Ontology ID)	FALSE	TRUE		"NCBITAXON:9606, Homo sapiens"	TRUE	1	subject	ontology					organism_id		organism_id	string	organism_id	string				
organism_deprecated	Organism (deprecated)	Organism (deprecated)		organism	string	FALSE	FALSE																organism		TRUE	FALSE	Repertoire	Subject			FALSE	string	Binomial designation of subject's species										TRUE	Field was renamed to species for clarity.	['species']		organism_deprecated		organism_deprecated	string	organism_deprecated	string				
organism_id_deprecated	Organism (deprecated)	Organism (deprecated)		organism_id	string	FALSE	FALSE																organism_id		TRUE	FALSE	Repertoire	Subject			FALSE	string	Binomial designation of subject's species (Ontology ID)										TRUE	Field was renamed to species for clarity.	['species']		organism_id_deprecated		organism_id_deprecated	string	organism_id_deprecated	string				
sex	Sex	Sex	sex	sex	string	FALSE	FALSE										Participant	biological_sex	enum	BiologicalSex		"Enum, Enum"	sex	Sex	TRUE	TRUE	Repertoire	Subject	subject.sex	subject.sex	FALSE	string	Biological sex of subject	Sex	TRUE	TRUE		female	TRUE	1	subject	controlled_vocabulary				"male,female,pooled,hermaphrodite,intersex,null"	sex		sex	string	sex	string				
ir_subject_age_min	Age minimum	Age minimum	age_min	age_min	number	FALSE	FALSE										Participant	age	word	positive number			age_min	Age minimum	TRUE	TRUE	Repertoire	Subject	subject.age_min	subject.age_min	FALSE	number	Specific age or lower boundary of age range.	Age minimum	TRUE	TRUE		60	TRUE	1	subject						age_min		age_min	number	age_min	number				
ir_subject_age_max	Age maximum	Age maximum	age_max	age_max	number	FALSE	FALSE																age_max	Age maximum	TRUE	TRUE	Repertoire	Subject	subject.age_max	subject.age_max	FALSE	number	Upper boundary of age range or equal to age_min for specific age. This field should only be null if age_min is null.	Age maximum	TRUE	TRUE		80	TRUE	1	subject						age_max		age_max	number	age_max	number				
age_unit	Age unit	Age unit	age_unit	age_unit	string	FALSE	FALSE										Participant	age_unit	word				age_unit	Age unit	TRUE	TRUE	Repertoire	Subject	subject.age_unit.label	subject.age_unit.label	FALSE	string	Unit of age range	Age unit	TRUE	TRUE		"UO:0000036, year"	TRUE	1	subject	ontology					age_unit		age_unit	string	age_unit	string				
age_unit_id	Age unit (Ontology ID)	Age unit (Ontology ID)	age_unit_id	age_unit_id	string	FALSE	FALSE																age_unit_id	Age unit (Ontology ID)	TRUE	TRUE	Repertoire	Subject	subject.age_unit.id	subject.age_unit.id	FALSE	string	Unit of age range (Ontology ID)	Age unit (Ontology ID)	TRUE	TRUE		"UO:0000036, year"	TRUE	1	subject	ontology					age_unit_id		age_unit_id	string	age_unit_id	string				
age_event	Age event	Age event	age_event	age_event	string	FALSE	FALSE										Participant	age_event	Class	LifeEvent		"String, Object"	age_event	Age event	TRUE	TRUE	Repertoire	Subject	subject.age_event	subject.age_event	FALSE	string	"Event in the study schedule to which `Age` refers. For NCBI BioSample this MUST be `sampling`. For other implementations submitters need to be aware that there is currently no mechanism to encode to potential delta between `Age event` and `Sample collection time`, hence the chosen events should be in temporal proximity."	Age event	TRUE	TRUE		enrollment	TRUE	1	subject						age_event		age_event	string	age_event	string				
age	Age (deprecated)	Age (deprecated)		age	string	FALSE	FALSE																age		TRUE	FALSE	Repertoire	Subject	subject.age	subject.age	FALSE	string											TRUE	Split into two fields to specify as an age range.	"['age_min', 'age_max', 'age_unit']"		age		age	string	age	string				
ancestry_population	Ancestry population	Ancestry	ancestry_population	ancestry_population	string	FALSE	FALSE										Participant	geolocation	GAZ:00000448	Geolocation		"String, Object"	ancestry_population	Ancestry population	TRUE	TRUE	Repertoire	Subject	subject.ancestry_population	subject.ancestry_population	FALSE	string	Broad geographic origin of ancestry (continent)	Ancestry population	TRUE	TRUE		"list of continents, mixed or unknown"	TRUE	1	subject						ancestry_population		ancestry_population	string	ancestry_population	string				
ethnicity	Ethnicity	Ethnicity	ethnicity	ethnicity	string	FALSE	FALSE										Participant	ethnicity	label	Ethnicity		"String, Object"	ethnicity	Ethnicity	TRUE	TRUE	Repertoire	Subject	subject.ethnicity	subject.ethnicity	FALSE	string	Ethnic group of subject (defined as cultural/language-based membership)	Ethnicity	TRUE	TRUE		"English, Kurds, Manchu, Yakuts (and other fields from Wikipedia)"	TRUE	1	subject						ethnicity		ethnicity	string	ethnicity	string				
race	Race	Race	race	race	string	FALSE	FALSE										Participant	race	word	Race		"String, Object"	race	Race	TRUE	TRUE	Repertoire	Subject	subject.race	subject.race	FALSE	string	Racial group of subject (as defined by NIH)	Race	TRUE	TRUE		"White, American Indian or Alaska Native, Black, Asian, Native Hawaiian or Other Pacific Islander, Other"	TRUE	1	subject						race		race	string	race	string				
strain_name	Strain name	Strain name	strain_name	strain_name	string	FALSE	FALSE										Participant	strain		Strain		"String, Object"	strain_name	Strain name	TRUE	TRUE	Repertoire	Subject	subject.strain_name	subject.strain_name	FALSE	string	Non-human designation of the strain or breed of animal used	Strain name	TRUE	TRUE		C57BL/6J	TRUE	1	subject						strain_name		strain_name	string	strain_name	string				
linked_subjects	Relation to other subjects	Relation (subjects)	linked_subjects	linked_subjects	string	FALSE	FALSE																linked_subjects	Relation to other subjects	TRUE	TRUE	Repertoire	Subject	subject.linked_subjects	subject.linked_subjects	FALSE	string	Subject ID to which `Relation type` refers	Relation to other subjects	TRUE	TRUE		SUB1355648	TRUE	1	subject						linked_subjects		linked_subjects	string	linked_subjects	string				
link_type	Relation type	Relation type	link_type	link_type	string	FALSE	FALSE																link_type	Relation type	TRUE	TRUE	Repertoire	Subject	subject.link_type	subject.link_type	FALSE	string	"Relation between subject and `linked_subjects`, can be genetic or environmental (e.g.exposure)"	Relation type	TRUE	TRUE		"father, daughter, household"	TRUE	1	subject						link_type		link_type	string	link_type	string				
study_group_description	Study group description	Study group	study_group_description	study_group_description	string	FALSE	FALSE										StudyArm	name	line	string			study_group_description	Study group description	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.study_group_description	subject.diagnosis.0.study_group_description	FALSE	string	Designation of study arm to which the subject is assigned to	Study group description	TRUE	TRUE		control	TRUE	1	diagnosis and intervention						study_group_description		study_group_description	string	study_group_description	string				
disease_diagnosis	Diagnosis	Diagnosis	disease_diagnosis	disease_diagnosis	string	FALSE	FALSE										ImmuneExposure	disease	label	Disease			disease_diagnosis	Diagnosis	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.disease_diagnosis.label	subject.diagnosis.0.disease_diagnosis.label	FALSE	string	Diagnosis of subject	Diagnosis	TRUE	TRUE		"DOID:9538, multiple myeloma"	TRUE	1	diagnosis and intervention	ontology					disease_diagnosis		disease_diagnosis	string	disease_diagnosis	string				
disease_diagnosis_id	Diagnosis (Ontology ID)	Diagnosis (Ontology ID)	disease_diagnosis_id	disease_diagnosis_id	string	FALSE	FALSE																disease_diagnosis_id	Diagnosis (Ontology ID)	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.disease_diagnosis.id	subject.diagnosis.0.disease_diagnosis.id	FALSE	string	Diagnosis of subject (Ontology ID)	Diagnosis (Ontology ID)	TRUE	TRUE		"DOID:9538, multiple myeloma"	TRUE	1	diagnosis and intervention	ontology					disease_diagnosis_id		disease_diagnosis_id	string	disease_diagnosis_id	string				
disease_length	Length of disease	Length of disease	disease_length	disease_length	string	FALSE	FALSE																disease_length	Length of disease	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.disease_length	subject.diagnosis.0.disease_length	FALSE	string	Time duration between initial diagnosis and current intervention	Length of disease	TRUE	TRUE		23 months	TRUE	1	diagnosis and intervention	physical_quantity					disease_length		disease_length	string	disease_length	string				
disease_stage	Disease stage	Disease stage	disease_stage	disease_stage	string	FALSE	FALSE										ImmuneExposure	disease_stage	label	DiseaseStage			disease_stage	Disease stage	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.disease_stage	subject.diagnosis.0.disease_stage	FALSE	string	Stage of disease at current intervention	Disease stage	TRUE	TRUE		Stage II	TRUE	1	diagnosis and intervention						disease_stage		disease_stage	string	disease_stage	string				
prior_therapies	Prior therapies for primary disease under study	Prior therapies	prior_therapies	prior_therapies	string	FALSE	FALSE																prior_therapies	Prior therapies for primary disease under study	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.prior_therapies	subject.diagnosis.0.prior_therapies	FALSE	string	List of all relevant previous therapies applied to subject for treatment of `Diagnosis`	Prior therapies for primary disease under study	TRUE	TRUE		melphalan/prednisone	TRUE	1	diagnosis and intervention						prior_therapies		prior_therapies	string	prior_therapies	string				
immunogen	Immunogen/agent	Immunogen/agent	immunogen	immunogen	string	FALSE	FALSE										ImmuneExposure	exposure_material	label				immunogen	Immunogen/agent	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.immunogen	subject.diagnosis.0.immunogen	FALSE	string	"Antigen, vaccine or drug applied to subject at this intervention"	Immunogen/agent	TRUE	TRUE		bortezomib	TRUE	1	diagnosis and intervention						immunogen		immunogen	string	immunogen	string				
intervention	Intervention definition	Intervention	intervention	intervention	string	FALSE	FALSE																intervention	Intervention definition	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.intervention	subject.diagnosis.0.intervention	FALSE	string	Description of intervention	Intervention definition	TRUE	TRUE		"systemic chemotherapy, 6 cycles, 1.25 mg/m2"	TRUE	1	diagnosis and intervention						intervention		intervention	string	intervention	string				
medical_history	Other relevant medical history	Medical history	medical_history	medical_history	string	FALSE	FALSE																medical_history	Other relevant medical history	TRUE	TRUE	Repertoire	Diagnosis	subject.diagnosis.medical_history	subject.diagnosis.0.medical_history	FALSE	string	Medical history of subject that is relevant to assess the course of disease and/or treatment	Other relevant medical history	TRUE	TRUE		"MGUS, first diagnosed 5 years prior"	TRUE	1	diagnosis and intervention						medical_history		medical_history	string	medical_history	string				
genotype				genotype	object	FALSE																					Repertoire	Genotype	subject.genotype	subject.genotype	FALSE	object			TRUE	TRUE				1	genotype	object					genotype									
genotype-receptor_genotype_set-receptor_genotype_set_id	Receptor genotype set ID	Receptor genotype set ID		genotype.receptor_genotype_set.receptor_genotype_set_id	string	FALSE	FALSE																receptor_genotype_set_id		TRUE	TRUE	Repertoire	GenotypeSet	subject.genotype.receptor_genotype_set.receptor_genotype_set_id	subject.genotype.receptor_genotype_set.receptor_genotype_set_id	FALSE	string	"A unique identifier for this Receptor Genotype Set, typically generated by the repository  hosting the schema, for example from the underlying ID of the database record."				TRUE		TRUE								receptor_genotype_set_id		receptor_genotype_set_id	string	receptor_genotype_set_id	string				
genotype-receptor_genotype_set-genotype_class_list-receptor_genotype_id	Receptor genotype ID	Receptor genotype ID		genotype.receptor_genotype_set.genotype_class_list.receptor_genotype_id	string	FALSE	FALSE																receptor_genotype_id		TRUE	TRUE	Repertoire	Genotype	subject.genotype.receptor_genotype_set.genotype_class_list.receptor_genotype_id	subject.genotype.receptor_genotype_set.genotype_class_list.0.receptor_genotype_id	FALSE	string	"A unique identifier within the file for this Receptor Genotype, typically generated by the  repository hosting the schema, for example from the underlying ID of the database record."				TRUE		TRUE								receptor_genotype_id		receptor_genotype_id	string	receptor_genotype_id	string				
genotype-receptor_genotype_set-genotype_class_list-locus	Receptor genotype locus	Receptor genotype locus		genotype.receptor_genotype_set.genotype_class_list.locus	string	FALSE	FALSE																locus		TRUE	TRUE	Repertoire	Genotype	subject.genotype.receptor_genotype_set.genotype_class_list.locus	subject.genotype.receptor_genotype_set.genotype_class_list.0.locus	FALSE	string	Gene locus		FALSE	TRUE		IGH	TRUE			controlled_vocabulary				"IGH,IGI,IGK,IGL,TRA,TRB,TRD,TRG"	locus		locus	string	locus	string				
genotype-receptor_genotype_set-genotype_class_list-documented_alleles-label	Receptor documented allele name	Receptor documented allele name		genotype.receptor_genotype_set.genotype_class_list.documented_alleles.label	string	FALSE	FALSE																label		TRUE	TRUE	Repertoire	DocumentedAllele	subject.genotype.receptor_genotype_set.genotype_class_list.documented_alleles.label	subject.genotype.receptor_genotype_set.genotype_class_list.0.documented_alleles.0.label	FALSE	string	"The accepted name for this allele, taken from the GermlineSet"						TRUE								label		label	string	label	string				
																																																								
genotype-receptor_genotype_set-genotype_class_list-documented_alleles-germline_set_ref	Receptor documented allele germline set	Receptor documented allele germline set		genotype.receptor_genotype_set.genotype_class_list.documented_alleles.germline_set_ref	string	FALSE	FALSE																germline_set_ref		TRUE	TRUE	Repertoire	DocumentedAllele	subject.genotype.receptor_genotype_set.genotype_class_list.documented_alleles.germline_set_ref	subject.genotype.receptor_genotype_set.genotype_class_list.0.documented_alleles.0.germline_set_ref	FALSE	string	"GermlineSet from which it was taken, referenced in standardized form (Repo:Label:Version)"					OGRDB:Human_IGH:2021.11	TRUE								germline_set_ref		germline_set_ref	string	germline_set_ref	string				
genotype-receptor_genotype_set-genotype_class_list-documented_alleles-phasing	Receptor documented allele phasing	Receptor documented allele phasing		genotype.receptor_genotype_set.genotype_class_list.documented_alleles.phasing	integer	FALSE	FALSE																phasing		TRUE	FALSE	Repertoire	DocumentedAllele	subject.genotype.receptor_genotype_set.genotype_class_list.documented_alleles.phasing	subject.genotype.receptor_genotype_set.genotype_class_list.0.documented_alleles.0.phasing	FALSE	integer	Chromosomal phasing indicator. Alleles with the same value are inferred to be located on the  same chromosome.		TRUE												phasing		phasing	integer	phasing	integer				
genotype-receptor_genotype_set-genotype_class_list-undocumented_alleles-allele_name	Receptor undocumented allele name	Receptor undocumented allele name		genotype.receptor_genotype_set.genotype_class_list.undocumented_alleles.allele_name	string	FALSE	FALSE																allele_name		TRUE	TRUE	Repertoire	UndocumentedAllele	subject.genotype.receptor_genotype_set.genotype_class_list.undocumented_alleles.allele_name	subject.genotype.receptor_genotype_set.genotype_class_list.0.undocumented_alleles.0.allele_name	FALSE	string	Allele name as allocated by the inference pipeline						TRUE								allele_name		allele_name	string	allele_name	string				
genotype-receptor_genotype_set-genotype_class_list-undocumented_alleles-sequence	Receptor undocumented allele sequence	Receptor undocumented allele sequence		genotype.receptor_genotype_set.genotype_class_list.undocumented_alleles.sequence	string	FALSE	FALSE																sequence		TRUE	TRUE	Repertoire	UndocumentedAllele	subject.genotype.receptor_genotype_set.genotype_class_list.undocumented_alleles.sequence	subject.genotype.receptor_genotype_set.genotype_class_list.0.undocumented_alleles.0.sequence	FALSE	string	"nt sequence of the allele, as provided by the inference pipeline"		FALSE				TRUE								sequence		sequence	string	sequence	string				
genotype-receptor_genotype_set-genotype_class_list-undocumented_alleles-phasing	Receptor undocumented allele phasing	Receptor undocumented allele phasing		genotype.receptor_genotype_set.genotype_class_list.undocumented_alleles.phasing	integer	FALSE	FALSE																phasing		TRUE	FALSE	Repertoire	UndocumentedAllele	subject.genotype.receptor_genotype_set.genotype_class_list.undocumented_alleles.phasing	subject.genotype.receptor_genotype_set.genotype_class_list.0.undocumented_alleles.0.phasing	FALSE	integer	Chromosomal phasing indicator. Alleles with the same value are inferred to be located on the  same chromosome.		TRUE												phasing		phasing	integer	phasing	integer				
genotype-receptor_genotype_set-genotype_class_list-deleted_genes-label	Receptor deleted gene name	Receptor deleted gene name		genotype.receptor_genotype_set.genotype_class_list.deleted_genes.label	string	FALSE	FALSE																label		TRUE	TRUE	Repertoire	DeletedGene	subject.genotype.receptor_genotype_set.genotype_class_list.deleted_genes.label	subject.genotype.receptor_genotype_set.genotype_class_list.0.deleted_genes.0.label	FALSE	string	"The accepted name for this gene, taken from the GermlineSet"		FALSE				TRUE								label		label	string	label	string				
genotype-receptor_genotype_set-genotype_class_list-deleted_genes-germline_set_ref	Receptor deleted gene germline set	Receptor deleted gene germline set		genotype.receptor_genotype_set.genotype_class_list.deleted_genes.germline_set_ref	string	FALSE	FALSE																germline_set_ref		TRUE	TRUE	Repertoire	DeletedGene	subject.genotype.receptor_genotype_set.genotype_class_list.deleted_genes.germline_set_ref	subject.genotype.receptor_genotype_set.genotype_class_list.0.deleted_genes.0.germline_set_ref	FALSE	string	GermlineSet from which it was taken (issuer/name/version)						TRUE								germline_set_ref		germline_set_ref	string	germline_set_ref	string				
genotype-receptor_genotype_set-genotype_class_list-deleted_genes-phasing	Receptor deleted gene phasing	Receptor deleted gene phasing		genotype.receptor_genotype_set.genotype_class_list.deleted_genes.phasing	integer	FALSE	FALSE																phasing		TRUE	FALSE	Repertoire	DeletedGene	subject.genotype.receptor_genotype_set.genotype_class_list.deleted_genes.phasing	subject.genotype.receptor_genotype_set.genotype_class_list.0.deleted_genes.0.phasing	FALSE	integer	Chromosomal phasing indicator. Alleles with the same value are inferred to be located on the  same chromosome.		TRUE												phasing		phasing	integer	phasing	integer				
genotype-receptor_genotype_set-genotype_class_list-inference_process	Receptor genotype inference process	Receptor genotype inference process		genotype.receptor_genotype_set.genotype_class_list.inference_process	string	FALSE	FALSE																inference_process		TRUE	FALSE	Repertoire	Genotype	subject.genotype.receptor_genotype_set.genotype_class_list.inference_process	subject.genotype.receptor_genotype_set.genotype_class_list.0.inference_process	FALSE	string	Information on how the genotype was acquired. Controlled vocabulary.	Genotype acquisition process	TRUE	TRUE		repertoire_sequencing				controlled_vocabulary				"genomic_sequencing,repertoire_sequencing,null"	inference_process		inference_process	string	inference_process	string		sample_processing_id	sample_processing_id	string
genotype-mhc_genotype_set-mhc_genotype_set_id	MHC genotype set ID	MHC genotype set ID		genotype.mhc_genotype_set.mhc_genotype_set_id	string	FALSE	FALSE																mhc_genotype_set_id		TRUE	TRUE	Repertoire	MHCGenotypeSet	subject.genotype.mhc_genotype_set.mhc_genotype_set_id	subject.genotype.mhc_genotype_set.mhc_genotype_set_id	FALSE	string	A unique identifier for this MHCGenotypeSet				TRUE		TRUE								mhc_genotype_set_id		mhc_genotype_set_id	string	mhc_genotype_set_id	string				
genotype-mhc_genotype_set-mhc_genotype_list-mhc_genotype_id	MHC genotype ID	MHC genotype ID		genotype.mhc_genotype_set.mhc_genotype_list.mhc_genotype_id	string	FALSE	FALSE																mhc_genotype_id		TRUE	TRUE	Repertoire	MHCGenotype	subject.genotype.mhc_genotype_set.mhc_genotype_list.mhc_genotype_id	subject.genotype.mhc_genotype_set.mhc_genotype_list.0.mhc_genotype_id	FALSE	string	"A unique identifier for this MHCGenotype, assumed to be unique in the context of the study"				TRUE		TRUE								mhc_genotype_id		mhc_genotype_id	string	mhc_genotype_id	string				
genotype-mhc_genotype_set-mhc_genotype_list-mhc_class	MHC genotype class	MHC genotype class		genotype.mhc_genotype_set.mhc_genotype_list.mhc_class	string	FALSE	FALSE																mhc_class		TRUE	TRUE	Repertoire	MHCGenotype	subject.genotype.mhc_genotype_set.mhc_genotype_list.mhc_class	subject.genotype.mhc_genotype_set.mhc_genotype_list.0.mhc_class	FALSE	string	Class of MHC alleles described by the MHCGenotype		FALSE	TRUE		MHC-I	TRUE			controlled_vocabulary				"MHC-I,MHC-II,MHC-nonclassical"	mhc_class		mhc_class	string	mhc_class	string				
genotype-mhc_genotype_set-mhc_genotype_list-mhc_alleles-allele_designation	MHC allele	MHC allele		genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.allele_designation	string	FALSE	FALSE																allele_designation		TRUE	FALSE	Repertoire	MHCAllele	subject.genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.allele_designation	subject.genotype.mhc_genotype_set.mhc_genotype_list.0.mhc_alleles.0.allele_designation	FALSE	string	"The accepted designation of an allele, usually its gene symbol plus allele/sub-allele/etc identifiers, if provided by the mhc_typing method"						TRUE								allele_designation		allele_designation	string	allele_designation	string				
genotype-mhc_genotype_set-mhc_genotype_list-mhc_alleles-gene-label	MHC gene name	MHC gene name		genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.gene.label	string	FALSE	FALSE																gene		TRUE	FALSE	Repertoire	MHCAllele	subject.genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.gene.label	subject.genotype.mhc_genotype_set.mhc_genotype_list.0.mhc_alleles.0.gene.label	FALSE	string	The MHC gene to which the described allele belongs	MHC gene		FALSE		"MRO:0000046, HLA-A"	TRUE			ontology					gene		gene	string	gene	string				
genotype-mhc_genotype_set-mhc_genotype_list-mhc_alleles-gene-id	MHC gene ID (ontology)	MHC gene ID (ontology)		genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.gene.id	string	FALSE	FALSE																gene_id		TRUE	FALSE	Repertoire	MHCAllele	subject.genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.gene.id	subject.genotype.mhc_genotype_set.mhc_genotype_list.0.mhc_alleles.0.gene.id	FALSE	string	The MHC gene to which the described allele belongs (Ontology ID)	MHC gene (Ontology ID)		FALSE		"MRO:0000046, HLA-A"	TRUE			ontology					gene_id		gene_id	string	gene_id	string				
genotype-mhc_genotype_set-mhc_genotype_list-mhc_alleles-reference_set_ref	MHC germline reference set	MHC germline reference set		genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.reference_set_ref	string	FALSE	FALSE																reference_set_ref		TRUE	FALSE	Repertoire	MHCAllele	subject.genotype.mhc_genotype_set.mhc_genotype_list.mhc_alleles.reference_set_ref	subject.genotype.mhc_genotype_set.mhc_genotype_list.0.mhc_alleles.0.reference_set_ref	FALSE	string	Repository and list from which it was taken (issuer/name/version)						TRUE								reference_set_ref		reference_set_ref	string	reference_set_ref	string				
genotype-mhc_genotype_set-mhc_genotype_list-mhc_genotyping_method	MHC genotype inference process	MHC genotype inference process		genotype.mhc_genotype_set.mhc_genotype_list.mhc_genotyping_method	string	FALSE	FALSE																mhc_genotyping_method		TRUE	FALSE	Repertoire	MHCGenotype	subject.genotype.mhc_genotype_set.mhc_genotype_list.mhc_genotyping_method	subject.genotype.mhc_genotype_set.mhc_genotype_list.0.mhc_genotyping_method	FALSE	string	Information on how the genotype was determined. The content of this field should come from a list of recommended terms provided in the AIRR Schema documentation.	MHC genotyping method		TRUE		pcr_low_resolution	TRUE								mhc_genotyping_method		mhc_genotyping_method	string	mhc_genotyping_method	string				
sample_processing_id	Sample Processing ID	Sample Processing ID	sample_processing_id	sample_processing_id	string	FALSE	FALSE																sample_processing_id	Sample processing ID	TRUE	FALSE	Repertoire	SampleProcessing	sample.sample_processing_id	sample.0.sample_processing_id	FALSE	string	"Identifier for the sample processing object. This field should be unique within the repertoire. This field can be used to uniquely identify the combination of sample, cell processing, nucleic acid processing and sequencing run information for the repertoire."	Sample processing ID	TRUE	TRUE	TRUE										sample_processing_id		sample_processing_id	string	sample_processing_id	string		sample_processing_id	sample_processing_id	string
sample_id	Biological sample ID	Sample ID	sample_id	sample_id	string	FALSE	FALSE										Specimen	name					sample_id	Biological sample ID	TRUE	TRUE	Repertoire	SampleProcessing	sample.sample_id	sample.0.sample_id	FALSE	string	"Sample ID assigned by submitter, unique within study. If possible, a persistent sample ID linked to INSDC or similar repository study should be used."	Biological sample ID	TRUE	TRUE	TRUE	SUP52415	TRUE	2	sample						sample_id		sample_id	string	sample_id	string				
sample_type	Sample type	Sample type	sample_type	sample_type	string	FALSE	FALSE										Specimen	specimen_type	line				sample_type	Sample type	TRUE	TRUE	Repertoire	SampleProcessing	sample.sample_type	sample.0.sample_type	FALSE	string	"The way the sample was obtained, e.g. fine-needle aspirate, organ harvest, peripheral venous puncture"	Sample type	TRUE	TRUE		Biopsy	TRUE	2	sample						sample_type		sample_type	string	sample_type	string				
tissue	Tissue	Tissue	tissue	tissue	string	FALSE	FALSE										Specimen	tissue	label			"Ontology, string"	tissue	Tissue	TRUE	TRUE	Repertoire	SampleProcessing	sample.tissue.label	sample.0.tissue.label	FALSE	string	"The actual tissue sampled, e.g. lymph node, liver, peripheral blood"	Tissue	TRUE	TRUE		"UBERON:0002371, bone marrow"	TRUE	2	sample	ontology					tissue		tissue	string	tissue	string				
tissue_id	Tissue (Ontology ID)	Tissue (Ontology ID)	tissue_id	tissue_id	string	FALSE	FALSE																tissue_id	Tissue (Ontology ID)	TRUE	TRUE	Repertoire	SampleProcessing	sample.tissue.id	sample.0.tissue.id	FALSE	string	"The actual tissue sampled, e.g. lymph node, liver, peripheral blood (Ontology ID)"	Tissue (Ontology ID)	TRUE	TRUE		"UBERON:0002371, bone marrow"	TRUE	2	sample	ontology					tissue_id		tissue_id	string	tissue_id	string				
anatomic_site	Anatomic site	Anatomic site	anatomic_site	anatomic_site	string	FALSE	FALSE																anatomic_site	Anatomic site	TRUE	TRUE	Repertoire	SampleProcessing	sample.anatomic_site	sample.0.anatomic_site	FALSE	string	"The anatomic location of the tissue, e.g. Inguinal, femur"	Anatomic site	TRUE	TRUE		Iliac crest	TRUE	2	sample						anatomic_site		anatomic_site	string	anatomic_site	string				
disease_state_sample	Disease state of sample	Disease state	disease_state_sample	disease_state_sample	string	FALSE	FALSE																disease_state_sample	Disease state of sample	TRUE	TRUE	Repertoire	SampleProcessing	sample.disease_state_sample	sample.0.disease_state_sample	FALSE	string	Histopathologic evaluation of the sample	Disease state of sample	TRUE	TRUE		Tumor infiltration	TRUE	2	sample						disease_state_sample		disease_state_sample	string	disease_state_sample	string				
collection_time_point_relative	Sample collection time	Collection time	collection_time_point_relative	collection_time_point_relative	number	FALSE	FALSE										LifeEvent	start	integer				collection_time_point_relative	Sample collection time	TRUE	TRUE	Repertoire	SampleProcessing	sample.collection_time_point_relative	sample.0.collection_time_point_relative	FALSE	number	"Time point at which sample was taken, relative to `Collection time event`"	Sample collection time	TRUE	TRUE		14	TRUE	2	sample						collection_time_point_relative		collection_time_point_relative	number	collection_time_point_relative	number				
collection_time_point_relative_unit	Sample collection time unit	Collection event	collection_time_point_relative_unit	collection_time_point_relative_unit	string	FALSE	FALSE										LifeEvent	time_unit	word				collection_time_point_relative_unit	Sample collection time unit	TRUE	TRUE	Repertoire	SampleProcessing	sample.collection_time_point_relative_unit.label	sample.0.collection_time_point_relative_unit.label	FALSE	string	Unit of Sample collection time	Sample collection time unit	TRUE	TRUE		"UO:0000033, day"	TRUE	2	sample	ontology					collection_time_point_relative_unit		collection_time_point_relative_unit	string	collection_time_point_relative_unit	string				
collection_time_point_relative_unit_id	Sample collection time unit (Ontology ID)	Collection event	collection_time_point_relative_unit_id	collection_time_point_relative_unit_id	string	FALSE	FALSE																collection_time_point_relative_unit_id	Sample collection time unit (Ontology ID)	TRUE	TRUE	Repertoire	SampleProcessing	sample.collection_time_point_relative_unit.id	sample.0.collection_time_point_relative_unit.id	FALSE	string	Unit of Sample collection time (Ontology ID)	Sample collection time unit (Ontology ID)	TRUE	TRUE		"UO:0000033, day"	TRUE	2	sample	ontology					collection_time_point_relative_unit_id		collection_time_point_relative_unit_id	string	collection_time_point_relative_unit_id	string				
collection_time_point_reference	Collection time event	Collection event	collection_time_point_reference	collection_time_point_reference	string	FALSE	FALSE										LifeEvent	t0_event	label				collection_time_point_reference	Collection time event	TRUE	TRUE	Repertoire	SampleProcessing	sample.collection_time_point_reference	sample.0.collection_time_point_reference	FALSE	string	Event in the study schedule to which `Sample collection time` relates to	Collection time event	TRUE	TRUE		Primary vaccination	TRUE	2	sample						collection_time_point_reference		collection_time_point_reference	string	collection_time_point_reference	string				
biomaterial_provider	Biomaterial provider	Biomaterial provider	biomaterial_provider	biomaterial_provider	string	FALSE	FALSE																biomaterial_provider	Biomaterial provider	TRUE	TRUE	Repertoire	SampleProcessing	sample.biomaterial_provider	sample.0.biomaterial_provider	FALSE	string	Name and address of the entity providing the sample	Biomaterial provider	TRUE	TRUE		"Tissues-R-Us, Tampa, FL, USA"	TRUE	2	sample						biomaterial_provider		biomaterial_provider	string	biomaterial_provider	string				
tissue_processing	Tissue processing	Tissue processing	tissue_processing	tissue_processing	string	FALSE	FALSE										CellIsolationProcessing	specimen	Class	Specimen			tissue_processing	Tissue processing	TRUE	TRUE	Repertoire	SampleProcessing	sample.tissue_processing	sample.0.tissue_processing	FALSE	string	Enzymatic digestion and/or physical methods used to isolate cells from sample	Tissue processing	TRUE	TRUE		"Collagenase A/Dnase I digested, followed by Percoll gradient"	TRUE	3	process (cell)						tissue_processing		tissue_processing	string	tissue_processing	string				
cell_subset	Cell subset	Cell subset	cell_subset	cell_subset	string	FALSE	FALSE										CellIsolationProcessing	cell_subset	Enum				cell_subset	Cell subset	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_subset.label	sample.0.cell_subset.label	FALSE	string	Commonly-used designation of isolated cell population	Cell subset	TRUE	TRUE		"CL:0000972, class switched memory B cell"	TRUE	3	process (cell)	ontology					cell_subset		cell_subset	string	cell_subset	string				
cell_subset_id	Cell subset (Ontology ID)	Cell subset (Ontology ID)	cell_subset_id	cell_subset_id	string	FALSE	FALSE																cell_subset_id	Cell subset (Ontology ID)	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_subset.id	sample.0.cell_subset.id	FALSE	string	Commonly-used designation of isolated cell population (Ontology ID)	Cell subset (Ontology ID)	TRUE	TRUE		"CL:0000972, class switched memory B cell"	TRUE	3	process (cell)	ontology					cell_subset_id		cell_subset_id	string	cell_subset_id	string				
cell_phenotype	Cell subset phenotype	Cell subset phenotype	cell_phenotype	cell_phenotype	string	FALSE	FALSE										CellIsolationProcessing	cell_phenotype	Enum				cell_phenotype	Cell subset phenotype	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_phenotype	sample.0.cell_phenotype	FALSE	string	List of cellular markers and their expression levels used to isolate the cell population	Cell subset phenotype	TRUE	TRUE		CD19+ CD38+ CD27+ IgM- IgD-	TRUE	3	process (cell)						cell_phenotype		cell_phenotype	string	cell_phenotype	string				
cell_species	Cell species	Cell species	cell_species	cell_species	string	FALSE	FALSE										CellIsolationProcessing	cell_species	boolean				cell_species	Cell species	TRUE	FALSE	Repertoire	SampleProcessing	sample.cell_species.label	sample.0.cell_species.label	FALSE	string	"Binomial designation of the species from which the analyzed cells originate. Typically, this value should be identical to `species`, in which case it SHOULD NOT be set explicitly. However, there are valid experimental setups in which the two might differ, e.g., chimeric animal models. If set, this key will overwrite the `species` information for all lower layers of the schema."	Cell species	TRUE	TRUE		"NCBITAXON:9606, Homo sapiens"	TRUE	3	process (cell)	ontology					cell_species		cell_species	string	cell_species	string				
cell_species_id	Cell species (Ontology ID)	Cell species (Ontology ID)	cell_species_id	cell_species_id	string	FALSE	FALSE																cell_species_id	Cell species (Ontology ID)	TRUE	FALSE	Repertoire	SampleProcessing	sample.cell_species.id	sample.0.cell_species.id	FALSE	string	"Binomial designation of the species from which the analyzed cells originate. Typically, this value should be identical to `species`, in which case it SHOULD NOT be set explicitly. However, there are valid experimental setups in which the two might differ, e.g., chimeric animal models. If set, this key will overwrite the `species` information for all lower layers of the schema. (Ontology ID)"	Cell species (Ontology ID)	TRUE	TRUE		"NCBITAXON:9606, Homo sapiens"	TRUE	3	process (cell)	ontology					cell_species_id		cell_species_id	string	cell_species_id	string				
single_cell	Single-cell sort	Single-cell sort	single_cell	single_cell	boolean	FALSE	FALSE										CellIsolationProcessing	single_cell	string				single_cell	Single-cell sort	TRUE	TRUE	Repertoire	SampleProcessing	sample.single_cell	sample.0.single_cell	FALSE	boolean	TRUE if single cells were isolated into separate compartments	Single-cell sort	TRUE	TRUE			TRUE	3	process (cell)						single_cell		single_cell	boolean	single_cell	boolean				
cell_number	Number of cells in experiment	# cells/experiment	cell_number	cell_number	integer	FALSE	FALSE										CellIsolationProcessing	cell_number	integer				cell_number	Number of cells in experiment	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_number	sample.0.cell_number	FALSE	integer	Total number of cells that went into the experiment	Number of cells in experiment	TRUE	TRUE		1000000	TRUE	3	process (cell)						cell_number		cell_number	integer	cell_number	integer				
cells_per_reaction	Number of cells per sequencing reaction	# cells/sequencing reaction	cells_per_reaction	cells_per_reaction	integer	FALSE	FALSE										CellIsolationProcessing	cells_per_reaction	integer				cells_per_reaction	Number of cells per sequencing reaction	TRUE	TRUE	Repertoire	SampleProcessing	sample.cells_per_reaction	sample.0.cells_per_reaction	FALSE	integer	Number of cells for each biological replicate	Number of cells per sequencing reaction	TRUE	TRUE		50000	TRUE	3	process (cell)						cells_per_reaction		cells_per_reaction	integer	cells_per_reaction	integer				
cell_storage	Cell storage	Cell storage	cell_storage	cell_storage	boolean	FALSE	FALSE										CellIsolationProcessing	cell_storage	string				cell_storage	Cell storage	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_storage	sample.0.cell_storage	FALSE	boolean	TRUE if cells were cryo-preserved between isolation and further processing	Cell storage	TRUE	TRUE		TRUE	TRUE	3	process (cell)						cell_storage		cell_storage	boolean	cell_storage	boolean				
cell_quality	Cell quality	Cell quality	cell_quality	cell_quality	string	FALSE	FALSE										CellIsolationProcessing	cell_quality	string				cell_quality	Cell quality	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_quality	sample.0.cell_quality	FALSE	string	Relative amount of viable cells after preparation and (if applicable) thawing	Cell quality	TRUE	TRUE		90% viability as determined by 7-AAD	TRUE	3	process (cell)						cell_quality		cell_quality	string	cell_quality	string				
cell_isolation	Cell isolation / enrichment procedure	Cell isolation procedure	cell_isolation	cell_isolation	string	FALSE	FALSE										CellIsolationProcessing	cell_isolation	string				cell_isolation	Cell isolation / enrichment procedure	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_isolation	sample.0.cell_isolation	FALSE	string	Description of the procedure used for marker-based isolation or enrich cells	Cell isolation / enrichment procedure	TRUE	TRUE		Cells were stained with fluorochrome labeled antibodies and then sorted on a FlowMerlin (CE) cytometer.	TRUE	3	process (cell)						cell_isolation		cell_isolation	string	cell_isolation	string				
cell_processing_protocol	Processing protocol	Processing protocol	cell_processing_protocol	cell_processing_protocol	string	FALSE	FALSE										CellIsolationProcessing	cell_processing_protocol	string				cell_processing_protocol	Processing protocol	TRUE	TRUE	Repertoire	SampleProcessing	sample.cell_processing_protocol	sample.0.cell_processing_protocol	FALSE	string	Description of the methods applied to the sample including cell preparation/ isolation/enrichment and nucleic acid extraction. This should closely mirror the Materials and methods section in the manuscript.	Processing protocol	TRUE	TRUE		Stimulated wih anti-CD3/anti-CD28	TRUE	3	process (cell)						cell_processing_protocol		cell_processing_protocol	string	cell_processing_protocol	string				
template_class	Target substrate	Target substrate	template_class	template_class	string	FALSE	FALSE										NucleicAcidProcessing	template_class	Enum	string			template_class	Target substrate	TRUE	TRUE	Repertoire	SampleProcessing	sample.template_class	sample.0.template_class	FALSE	string	The class of nucleic acid that was used as primary starting material for the following procedures	Target substrate	FALSE	TRUE		RNA	TRUE	3	process (nucleic acid)	controlled_vocabulary				"DNA,RNA"	template_class		template_class	string	template_class	string				
template_quality	Target substrate quality	Target substrate quality	template_quality	template_quality	string	FALSE	FALSE										NucleicAcidProcessing	template_quality	label	string			template_quality	Target substrate quality	TRUE	TRUE	Repertoire	SampleProcessing	sample.template_quality	sample.0.template_quality	FALSE	string	Description and results of the quality control performed on the template material	Target substrate quality	TRUE	TRUE		RIN 9.2	TRUE	3	process (nucleic acid)						template_quality		template_quality	string	template_quality	string				
template_amount	Template amount	Template amount	template_amount	template_amount	number	FALSE	FALSE										NucleicAcidProcessing	template_amount	number	number			template_amount	Template amount	TRUE	TRUE	Repertoire	SampleProcessing	sample.template_amount	sample.0.template_amount	FALSE	number	Amount of template that went into the process	Template amount	TRUE	TRUE		1000	TRUE	3	process (nucleic acid)						template_amount		template_amount	number	template_amount	number				
template_amount_unit	Template amount time unit	Template amount time unit	template_amount_unit	template_amount_unit	string	FALSE	FALSE										NucleicAcidProcessing	template_amount_unit	unit	string			template_amount_unit	Template amount time unit	TRUE	TRUE	Repertoire	SampleProcessing	sample.template_amount_unit.label	sample.0.template_amount_unit.label	FALSE	string	Unit of template amount	Template amount time unit	TRUE	TRUE		"UO:0000024, nanogram"	TRUE	3	process (nucleic acid)	ontology					template_amount_unit		template_amount_unit	string	template_amount_unit	string				
template_amount_unit_id	Template amount time unit (Ontology ID)	Template amount time unit (Ontology ID)	template_amount_unit_id	template_amount_unit_id	string	FALSE	FALSE																template_amount_unit_id	Template amount time unit (Ontology ID)	TRUE	TRUE	Repertoire	SampleProcessing	sample.template_amount_unit.id	sample.0.template_amount_unit.id	FALSE	string	Unit of template amount (Ontology ID)	Template amount time unit (Ontology ID)	TRUE	TRUE		"UO:0000024, nanogram"	TRUE	3	process (nucleic acid)	ontology					template_amount_unit_id		template_amount_unit_id	string	template_amount_unit_id	string				
library_generation_method	Library generation method	Library generation method	library_generation_method	library_generation_method	string	FALSE	FALSE										LibraryPreparationProcessing	library_generation_method	Enum	string			library_generation_method	Library generation method	TRUE	TRUE	Repertoire	SampleProcessing	sample.library_generation_method	sample.0.library_generation_method	FALSE	string	Generic type of library generation	Library generation method	FALSE	TRUE		RT(oligo-dT)+TS(UMI)+PCR	TRUE	3	process (nucleic acid)	controlled_vocabulary				"PCR,RT(RHP)+PCR,RT(oligo-dT)+PCR,RT(oligo-dT)+TS+PCR,RT(oligo-dT)+TS(UMI)+PCR,RT(specific)+PCR,RT(specific)+TS+PCR,RT(specific)+TS(UMI)+PCR,RT(specific+UMI)+PCR,RT(specific+UMI)+TS+PCR,RT(specific)+TS,other"	library_generation_method		library_generation_method	string	library_generation_method	string				
library_generation_protocol	Library generation protocol	Library generation protocol	library_generation_protocol	library_generation_protocol	string	FALSE	FALSE										LibraryPreparationProcessing	library_generation_protocol	label	string			library_generation_protocol	Library generation protocol	TRUE	TRUE	Repertoire	SampleProcessing	sample.library_generation_protocol	sample.0.library_generation_protocol	FALSE	string	Description of processes applied to substrate to obtain a library that is ready for sequencing	Library generation protocol	TRUE	TRUE		cDNA was generated using	TRUE	3	process (nucleic acid)						library_generation_protocol		library_generation_protocol	string	library_generation_protocol	string				
library_generation_kit_version	Protocol IDs	Protocol IDs	library_generation_kit_version	library_generation_kit_version	string	FALSE	FALSE										LibraryPreparationProcessing	library_generation_kit_version	label	string			library_generation_kit_version	Protocol IDs	TRUE	TRUE	Repertoire	SampleProcessing	sample.library_generation_kit_version	sample.0.library_generation_kit_version	FALSE	string	"When using a library generation protocol from a commercial provider, provide the protocol version number"	Protocol IDs	TRUE	TRUE		v2.1 (2016-09-15)	TRUE	3	process (nucleic acid)						library_generation_kit_version		library_generation_kit_version	string	library_generation_kit_version	string				
pcr_target_locus	Target locus for PCR	PCR target	pcr_target_locus	pcr_target_locus	string	FALSE	FALSE										ReceptorRepertoireSequencingAssay	pcr_target	label	string	TRUE		pcr_target_locus	Target locus for PCR	TRUE	TRUE	Repertoire	PCRTarget	sample.pcr_target.pcr_target_locus	sample.0.pcr_target.0.pcr_target_locus	FALSE	string	"Designation of the target locus. Note that this field uses a controlled vocubulary that is meant to provide a generic classification of the locus, not necessarily the correct designation according to a specific nomenclature."	Target locus for PCR	TRUE	TRUE		IGK	TRUE	3	process (nucleic acid [pcr])	controlled_vocabulary				"IGH,IGI,IGK,IGL,TRA,TRB,TRD,TRG,null"	pcr_target_locus		pcr_target_locus	string	pcr_target_locus	string				
forward_pcr_primer_target_location	Forward PCR primer target location	Forward PCR target	forward_pcr_primer_target_location	forward_pcr_primer_target_location	string	FALSE	FALSE																forward_pcr_primer_target_location	Forward PCR primer target location	TRUE	TRUE	Repertoire	PCRTarget	sample.pcr_target.forward_pcr_primer_target_location	sample.0.pcr_target.0.forward_pcr_primer_target_location	FALSE	string	Position of the most distal nucleotide templated by the forward primer or primer mix	Forward PCR primer target location	TRUE	TRUE		"IGHV, +23"	TRUE	3	process (nucleic acid [pcr])						forward_pcr_primer_target_location		forward_pcr_primer_target_location	string	forward_pcr_primer_target_location	string				
reverse_pcr_primer_target_location	Reverse PCR primer target location	Reverse PCR target	reverse_pcr_primer_target_location	reverse_pcr_primer_target_location	string	FALSE	FALSE																reverse_pcr_primer_target_location	Reverse PCR primer target location	TRUE	TRUE	Repertoire	PCRTarget	sample.pcr_target.reverse_pcr_primer_target_location	sample.0.pcr_target.0.reverse_pcr_primer_target_location	FALSE	string	Position of the most proximal nucleotide templated by the reverse primer or primer mix	Reverse PCR primer target location	TRUE	TRUE		"IGHG, +57"	TRUE	3	process (nucleic acid [pcr])						reverse_pcr_primer_target_location		reverse_pcr_primer_target_location	string	reverse_pcr_primer_target_location	string				
complete_sequences	Complete sequences	Complete sequences	complete_sequences	complete_sequences	string	FALSE	FALSE										ReceptorRepertoireSequencingAssay	complete_sequences	Enum	string			complete_sequences	Complete sequences	TRUE	TRUE	Repertoire	SampleProcessing	sample.complete_sequences	sample.0.complete_sequences	FALSE	string	"To be considered `complete`, the procedure used for library construction MUST generate sequences that 1) include the first V gene codon that encodes the mature polypeptide chain (i.e. after the leader sequence) and 2) include the last complete codon of the J gene (i.e. 1 bp 5' of the J->C splice site) and 3) provide sequence information for all positions between 1) and 2). To be considered `complete & untemplated`, the sections of the sequences defined in points 1) to 3) of the previous sentence MUST be untemplated, i.e. MUST NOT overlap with the primers used in library preparation. `mixed` should only be used if the procedure used for library construction will likely produce multiple categories of sequences in the given experiment. It SHOULD NOT be used as a replacement of a NULL value."	Complete sequences	FALSE	TRUE		partial	TRUE	3	process (nucleic acid)	controlled_vocabulary				"partial,complete,complete+untemplated,mixed"	complete_sequences		complete_sequences	string	complete_sequences	string				
physical_linkage	Physical linkage of different rearrangements	Linkage of loci	physical_linkage	physical_linkage	string	FALSE	FALSE										ReceptorRepertoireSequencingAssay	physical_linkage	Enum	string			physical_linkage	Physical linkage of different rearrangements	TRUE	TRUE	Repertoire	SampleProcessing	sample.physical_linkage	sample.0.physical_linkage	FALSE	string	"In case an experimental setup is used that physically links nucleic acids derived from distinct `Rearrangements` before library preparation, this field describes the mode of that linkage. All `hetero_*` terms indicate that in case of paired-read sequencing, the two reads should be expected to map to distinct IG/TR loci. `*_head-head` refers to techniques that link the 5' ends of transcripts in a single-cell context. `*_tail-head` refers to techniques that link the 3' end of one transcript to the 5' end of another one in a single-cell context. This term does not provide any information whether a continuous reading-frame between the two is generated. `*_prelinked` refers to constructs in which the linkage was already present on the DNA level (e.g. scFv)."	Physical linkage of different rearrangements	FALSE	TRUE		hetero_head-head	TRUE	3	process (nucleic acid)	controlled_vocabulary				"none,hetero_head-head,hetero_tail-head,hetero_prelinked"	physical_linkage		physical_linkage	string	physical_linkage	string				
sequencing_run_id	Batch number	Batch number	sequencing_run_id	sequencing_run_id	string	FALSE	FALSE																sequencing_run_id	Batch number	TRUE	TRUE	Repertoire	SampleProcessing	sample.sequencing_run_id	sample.0.sequencing_run_id	FALSE	string	ID of sequencing run assigned by the sequencing facility	Batch number	TRUE	TRUE	TRUE	160101_M01234	TRUE	3	process (sequencing)						sequencing_run_id		sequencing_run_id	string	sequencing_run_id	string				
total_reads_passing_qc_filter	Total reads passing QC filter	Reads passing QC	total_reads_passing_qc_filter	total_reads_passing_qc_filter	integer	FALSE	FALSE																total_reads_passing_qc_filter	Total reads passing QC filter	TRUE	TRUE	Repertoire	SampleProcessing	sample.total_reads_passing_qc_filter	sample.0.total_reads_passing_qc_filter	FALSE	integer	Number of usable reads for analysis	Total reads passing QC filter	TRUE	TRUE		10365118	TRUE	3	process (sequencing)						total_reads_passing_qc_filter		total_reads_passing_qc_filter	integer	total_reads_passing_qc_filter	integer				
sequencing_platform	Sequencing platform	Sequencing platform	sequencing_platform	sequencing_platform	string	FALSE	FALSE																sequencing_platform	Sequencing platform	TRUE	TRUE	Repertoire	SampleProcessing	sample.sequencing_platform	sample.0.sequencing_platform	FALSE	string	Designation of sequencing instrument used	Sequencing platform	TRUE	TRUE		Alumina LoSeq 1000	TRUE	3	process (sequencing)						sequencing_platform		sequencing_platform	string	sequencing_platform	string				
																																																								
sequencing_facility	Sequencing facility	Sequencing facility	sequencing_facility	sequencing_facility	string	FALSE	FALSE																sequencing_facility	Sequencing facility	TRUE	TRUE	Repertoire	SampleProcessing	sample.sequencing_facility	sample.0.sequencing_facility	FALSE	string	Name and address of sequencing facility	Sequencing facility	TRUE	TRUE		"Seqs-R-Us, Vancouver, BC, Canada"	TRUE	3	process (sequencing)						sequencing_facility		sequencing_facility	string	sequencing_facility	string				
sequencing_run_date	Date of sequencing run	Date of sequencing run	sequencing_run_date	sequencing_run_date	string	FALSE	FALSE																sequencing_run_date	Date of sequencing run	TRUE	TRUE	Repertoire	SampleProcessing	sample.sequencing_run_date	sample.0.sequencing_run_date	FALSE	string	Date of sequencing run	Date of sequencing run	TRUE	TRUE		42720	TRUE	3	process (sequencing)	date					sequencing_run_date		sequencing_run_date	string	sequencing_run_date	string				
sequencing_kit	Sequencing kit	Sequencing kit	sequencing_kit	sequencing_kit	string	FALSE	FALSE																sequencing_kit	Sequencing kit	TRUE	TRUE	Repertoire	SampleProcessing	sample.sequencing_kit	sample.0.sequencing_kit	FALSE	string	"Name, manufacturer, order and lot numbers of sequencing kit"	Sequencing kit	TRUE	TRUE		"FullSeq 600, Alumina, #M123456C0, 789G1HK"	TRUE	3	process (sequencing)						sequencing_kit		sequencing_kit	string	sequencing_kit	string				
sequencing_data_id	Raw data persistent identifier	Raw Data PID	sequencing_data_id	sequencing_data_id	string	FALSE	FALSE																sequencing_data_id		TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.sequencing_data_id	sample.0.sequencing_files.sequencing_data_id	FALSE	string	Persistent identifier of raw data stored in an archive (e.g. INSDC run ID). Data archive should  be identified in the CURIE prefix.	Raw sequencing data persistent identifier	TRUE	TRUE	TRUE	SRA:SRR11610494	TRUE	4	data (raw reads)	CURIE					sequencing_data_id		sequencing_data_id	string	sequencing_data_id	string				
file_type	Raw sequencing data file type	Sequencing file type	file_type	file_type	string	FALSE	FALSE																file_type	Raw sequencing data file type	TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.file_type	sample.0.sequencing_files.file_type	FALSE	string	File format for the raw reads or sequences	Raw sequencing data file type	TRUE	TRUE			TRUE	4	data (raw reads)	controlled_vocabulary				"fasta,fastq,null"	file_type		file_type	string	file_type	string				
filename	Raw sequencing data file name	Sequencing file name	filename	filename	string	FALSE	FALSE																filename	Raw sequencing data file name	TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.filename	sample.0.sequencing_files.filename	FALSE	string	File name for the raw reads or sequences. The first file in paired-read sequencing.	Raw sequencing data file name	TRUE	TRUE		MS10R-NMonson-C7JR9_S1_R1_001.fastq	TRUE	4	data (raw reads)						filename		filename	string	filename	string				
read_direction	Read direction	Read direction	read_direction	read_direction	string	FALSE	FALSE																read_direction	Read direction	TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.read_direction	sample.0.sequencing_files.read_direction	FALSE	string	Read direction for the raw reads or sequences. The first file in paired-read sequencing.	Read direction	TRUE	TRUE		forward	TRUE	4	data (raw reads)	controlled_vocabulary				"forward,reverse,mixed,null"	read_direction		read_direction	string	read_direction	string				
read_length	Forward read length	Forward read length	read_length	read_length	integer	FALSE	FALSE																read_length	Forward read length	TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.read_length	sample.0.sequencing_files.read_length	FALSE	integer	Read length in bases for the first file in paired-read sequencing	Forward read length	TRUE	TRUE		300	TRUE	4	data (raw reads)						read_length		read_length	integer	read_length	integer				
paired_filename	Paired raw sequencing data file name	Paired sequencing  file name	paired_filename	paired_filename	string	FALSE	FALSE																paired_filename	Paired raw sequencing data file name	TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.paired_filename	sample.0.sequencing_files.paired_filename	FALSE	string	File name for the second file in paired-read sequencing	Paired raw sequencing data file name	TRUE	TRUE		MS10R-NMonson-C7JR9_S1_R2_001.fastq	TRUE	4	data (raw reads)						paired_filename		paired_filename	string	paired_filename	string				
paired_read_direction	Paired read direction	Paired read direction	paired_read_direction	paired_read_direction	string	FALSE	FALSE																paired_read_direction	Paired read direction	TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.paired_read_direction	sample.0.sequencing_files.paired_read_direction	FALSE	string	Read direction for the second file in paired-read sequencing	Paired read direction	TRUE	TRUE		reverse	TRUE	4	data (raw reads)	controlled_vocabulary				"forward,reverse,mixed,null"	paired_read_direction		paired_read_direction	string	paired_read_direction	string				
paired_read_length	Paired read length	Paired read length	paired_read_length	paired_read_length	integer	FALSE	FALSE																paired_read_length	Paired read length	TRUE	TRUE	Repertoire	SequencingData	sample.sequencing_files.paired_read_length	sample.0.sequencing_files.paired_read_length	FALSE	integer	Read length in bases for the second file in paired-read sequencing	Paired read length	TRUE	TRUE		300	TRUE	4	data (raw reads)						paired_read_length		paired_read_length	integer	paired_read_length	integer				
index_filename			index_filename	index_filename	string	FALSE	FALSE																index_filename		TRUE	FALSE	Repertoire	SequencingData	sample.sequencing_files.index_filename	sample.0.sequencing_files.index_filename	FALSE	string	File name for the index file	Sequencing index file name	TRUE	TRUE		MS10R-NMonson-C7JR9_S1_R3_001.fastq									index_filename		index_filename	string	index_filename	string				
index_length			index_length	index_length	integer	FALSE	FALSE																index_length		TRUE	FALSE	Repertoire	SequencingData	sample.sequencing_files.index_length	sample.0.sequencing_files.index_length	FALSE	integer	Read length in bases for the index file	Index read length	TRUE	TRUE		8									index_length		index_length	integer	index_length	integer				
data_processing_id	Data processing ID	Data processing ID	data_processing_id	data_processing_id	string	FALSE	FALSE																data_processing_id	Data processing ID	TRUE	FALSE	Repertoire	DataProcessing	data_processing.data_processing_id	data_processing.0.data_processing_id	FALSE	string	Identifier for the data processing object.	Data processing ID	TRUE	TRUE	TRUE										data_processing_id		data_processing_id	string	data_processing_id	string		data_processing_id	data_processing_id	string
primary_annotation	Primary annotation	Primary annotation	primary_annotation	primary_annotation	boolean	FALSE	FALSE																primary_annotation		TRUE	FALSE	Repertoire	DataProcessing	data_processing.primary_annotation	data_processing.0.primary_annotation	FALSE	boolean	"If true, indicates this is the primary or default data processing for the repertoire and its rearrangements. If false, indicates this is a secondary or additional data processing."	Primary annotation	FALSE	TRUE	TRUE										primary_annotation		primary_annotation	boolean	primary_annotation	boolean				
software_versions	Software tools and version numbers	Software tools/versions	software_versions	software_versions	string	FALSE	FALSE																software_versions	Software tools and version numbers	TRUE	TRUE	Repertoire	DataProcessing	data_processing.software_versions	data_processing.0.software_versions	FALSE	string	"Version number and / or date, include company pipelines"	Software tools and version numbers	TRUE	TRUE		IgBLAST 1.6	TRUE	5	process (computational)						software_versions		software_versions	string	software_versions	string				
paired_reads_assembly	Paired read assembly	Paired read assembly	paired_reads_assembly	paired_reads_assembly	string	FALSE	FALSE																paired_reads_assembly	Paired read assembly	TRUE	TRUE	Repertoire	DataProcessing	data_processing.paired_reads_assembly	data_processing.0.paired_reads_assembly	FALSE	string	How paired end reads were assembled into a single receptor sequence	Paired read assembly	TRUE	TRUE		"PandaSeq (minimal overlap 50, threshold 0.8)"	TRUE	5	process (computational)						paired_reads_assembly		paired_reads_assembly	string	paired_reads_assembly	string				
quality_thresholds	Quality thresholds	Quality thresholds	quality_thresholds	quality_thresholds	string	FALSE	FALSE																quality_thresholds	Quality thresholds	TRUE	TRUE	Repertoire	DataProcessing	data_processing.quality_thresholds	data_processing.0.quality_thresholds	FALSE	string	How/if sequences were removed from (4) based on base quality scores	Quality thresholds	TRUE	TRUE		Average Phred score >=20	TRUE	5	process (computational)						quality_thresholds		quality_thresholds	string	quality_thresholds	string				
primer_match_cutoffs	Primer match cutoffs	Primer match cutoffs	primer_match_cutoffs	primer_match_cutoffs	string	FALSE	FALSE																primer_match_cutoffs	Primer match cutoffs	TRUE	TRUE	Repertoire	DataProcessing	data_processing.primer_match_cutoffs	data_processing.0.primer_match_cutoffs	FALSE	string	"How primers were identified in the sequences, were they removed/masked/etc?"	Primer match cutoffs	TRUE	TRUE		Hamming distance <= 2	TRUE	5	process (computational)						primer_match_cutoffs		primer_match_cutoffs	string	primer_match_cutoffs	string				
collapsing_method	Collapsing method	Collapsing method	collapsing_method	collapsing_method	string	FALSE	FALSE																collapsing_method	Collapsing method	TRUE	TRUE	Repertoire	DataProcessing	data_processing.collapsing_method	data_processing.0.collapsing_method	FALSE	string	The method used for combining multiple sequences from (4) into a single sequence in (5)	Collapsing method	TRUE	TRUE		MUSCLE 3.8.31	TRUE	5	process (computational)						collapsing_method		collapsing_method	string	collapsing_method	string				
data_processing_protocols	Data processing protocols	Data processing protocols	data_processing_protocols	data_processing_protocols	string	FALSE	FALSE																data_processing_protocols	Data processing protocols	TRUE	TRUE	Repertoire	DataProcessing	data_processing.data_processing_protocols	data_processing.0.data_processing_protocols	FALSE	string	General description of how QC is performed	Data processing protocols	TRUE	TRUE		Data was processed using [...]	TRUE	5	process (computational)						data_processing_protocols		data_processing_protocols	string	data_processing_protocols	string				
ir_rearrangement_file_name	Processed data file names	Processed files	data_processing_files	data_processing_files	string	TRUE	FALSE																data_processing_files	Processed data file names	TRUE	FALSE	Repertoire	DataProcessing	data_processing.data_processing_files	data_processing.0.data_processing_files	TRUE	string	Array of file names for data produced by this data processing.	Processed data file names	TRUE	TRUE		"['ERR1278153_aa.txz', 'ERR1278153_ab.txz', 'ERR1278153_ac.txz']"									data_processing_files		data_processing_files	string	data_processing_files	string				
germline_database	V(D)J germline reference database	V(D)J germline database	germline_database	germline_database	string	FALSE	FALSE																germline_database	V(D)J germline reference database	TRUE	TRUE	Repertoire	DataProcessing	data_processing.germline_database	data_processing.0.germline_database	FALSE	string	Source of germline V(D)J genes with version number or date accessed.	V(D)J germline reference database	TRUE	TRUE		"ENSEMBL, Homo sapiens build 90, 2017-10-01"	TRUE	5	data (processed sequence)						germline_database		germline_database	string	germline_database	string				
germline_set_ref	Unique identifier of Germline Reference	Germline ID	germline_set_ref	germline_set_ref	string	FALSE	FALSE																germline_set_ref		TRUE	FALSE	Repertoire	DataProcessing	data_processing.germline_set_ref	data_processing.0.germline_set_ref	FALSE	string	"Unique identifier of the germline set and version, in standardized form (Repo:Label:Version)"		TRUE	TRUE		OGRDB:Human_IGH:2021.11									germline_set_ref		germline_set_ref	string	germline_set_ref	string				
analysis_provenance_id	Analysis Provenance ID	Analysis ID	analysis_provenance_id	analysis_provenance_id	string	FALSE	FALSE																analysis_provenance_id		TRUE	FALSE	Repertoire	DataProcessing	data_processing.analysis_provenance_id	data_processing.0.analysis_provenance_id	FALSE	string	Identifier for machine-readable PROV model of analysis provenance	Analysis provenance ID	TRUE	TRUE											analysis_provenance_id		analysis_provenance_id	string	analysis_provenance_id	string				
																																																								
ir_sequence_count	# Annotated Sequences	# Annotated Sequences		ir_sequence_count	integer	FALSE	FALSE																				IR_Repertoire	IR_API			FALSE	integer															ir_sequence_count									
ir_filtered_sequence_count				ir_filtered_sequence_count	integer	FALSE	FALSE																				IR_Repertoire	IR_API			FALSE	integer																								
ir_clone_count	# Annotated Clones	# Annotated Clones		ir_clone_count	integer	FALSE	FALSE																				IR_Repertoire	IR_API			FALSE	integer															ir_clone_count									
ir_cell_count	# Annotated Cells	# Annotated Cells		ir_cell_count	integer	FALSE	FALSE																				IR_Repertoire	IR_API			FALSE	integer															ir_cell_count									
ir_expression_count	# Annotated Expression Markers	# Annotated Expression Markers		ir_expression_count	integer	FALSE	FALSE																				IR_Repertoire	IR_API			FALSE	integer															ir_expression_count									
ir_username																											IR_Repertoire	IR_Parameter																												
																																																								
																																																								
ir_project_sample_id_list							FALSE																				IR_Repertoire	IR_Parameter																			ir_project_sample_id_list		ir_project_sample_id_list	array						
ir_data_format							FALSE																				IR_Repertoire	IR_Parameter																												
ir_show_unproductive							FALSE																				IR_Repertoire	IR_Parameter																												
																																																								
																																																								
ir_library_source																											IR_Repertoire	IR_Curator			FALSE	string																								
																																																								
ir_igblast_file_name				ir_igblast_file_name	string	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	string																								
ir_imgt_file_name				ir_imgt_file_name	string	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	string																								
ir_mixcr_file_name				ir_mixcr_file_name	string	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	string																								
ir_rearrangement_tool				ir_rearrangement_tool	string	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	string																								
ir_record_number			ir_record_number	ir_record_number	integer	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	integer																								
ir_rearrangement_number				ir_rearrangement_number	integer	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	integer																								
ir_annotation_set_metadata_id				ir_annotation_set_metadata_id	string	FALSE	FALSE																				IR_Repertoire				FALSE	string															ir_annotation_set_metadata_id									
ir_ancillary_rearrangement_file_name				ir_ancillary_rearrangement_file_name	string	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	string																								
ir_created_at_repertoire				ir_created_at	string	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	string															ir_created_at									
ir_updated_at_repertoire				ir_updated_at	string	FALSE	FALSE																				IR_Repertoire	IR_Curator			FALSE	string															ir_updated_at									
																																																								
																																																								
ir_akc_plans_																		plans		"Plan, multivalued"																											0									
																																																								
																																																								
ir_akc_akc_id_Investigation																	Investigation	akc_id	id	identifier							AKC_Metadata	AKC_Investigation																												
ir_akc_name_Investigation																	Investigation	name	line	string							AKC_Metadata	AKC_Investigation																			0									
ir_akc_description_Investigation																	Investigation	description	line	string							AKC_Metadata	AKC_Investigation																			0									
ir_akc_archival_id_Investigation																	Investigation	archival_id	line	uriorcurie							AKC_Metadata	AKC_Investigation																			0									
ir_akc_study_type_Investigation																	Investigation	study_type	Enum	StudyType		"Ontology, Enum"					AKC_Metadata	AKC_Investigation																			0									
ir_akc_inclusion_criteria_Investigation																	Investigation	inclusion_criteria	line	string		"String, String"					AKC_Metadata	AKC_Investigation																			0									
ir_akc_exclusion_criteria_Investigation																	Investigation	exclusion_criteria		string		"String, String"					AKC_Metadata	AKC_Investigation																			0									
ir_akc_release_date_Investigation																	Investigation	release_date		datetime							AKC_Metadata	AKC_Investigation																												
ir_akc_update_date_Investigation																	Investigation	update_date		datetime							AKC_Metadata	AKC_Investigation																			0									
ir_akc_brief_description_Investigation																	Investigation	brief_description	line	string							AKC_Metadata	AKC_Investigation																			0									
ir_akc_participants_Investigation																	Investigation	participants	Class	Participant	TRUE						AKC_Metadata	AKC_Investigation																			0									
ir_akc_documents_Investigation																	Investigation	documents	Class	Reference	TRUE						AKC_Metadata	AKC_Investigation																			0									
ir_akc_assays_Investigation																	Investigation	assays	Class	ReceptorRepertoireSequencingAssay	TRUE						AKC_Metadata	AKC_Investigation																			0									
ir_akc_simulations_Investigation																	Investigation	simulations	Class	Simulation	TRUE						AKC_Metadata	AKC_Investigation																			0									
ir_akc_conclusions_Investigation																	Investigation	conclusions	Class	Conclusions	TRUE						AKC_Metadata	AKC_Investigation																												
ir_akc_grants_Investigation																	Investigation	grants		Grants	TRUE						AKC_Metadata	AKC_Investigation																			0									
ir_akc_contact_Investigation																	Investigation	contact		Person							AKC_Metadata	AKC_Investigation																			0									
ir_akc_contributors_Investigation																	Investigation	contributors		Contributor	TRUE						AKC_Metadata	AKC_Investigation																			0									
																																																								
																																																								
																																																								
																																																								
																																																								
																																																								
																																																								
ir_akc_id_reference																	reference	id	id								AKC_Metadata	AKC_reference																			0									
ir_akc_pubmed_id_reference																	reference	pubmed_id	integer	CURIE (PMID)							AKC_Metadata	AKC_reference																			0									
ir_akc_doi_reference																	reference	doi	label	CURIE (DOI)							AKC_Metadata	AKC_reference																			0									
ir_akc_source_uri_reference																	reference	source_uri		"CURIE (DOI, PMID, ...)"							AKC_Metadata	AKC_reference																												
																																																								
ir_akc_title_Reference																	Reference	title	line	string							AKC_Metadata	AKC_Reference																			0									
ir_akc_authors_Reference																	Reference	authors	line	multivalued	TRUE						AKC_Metadata	AKC_Reference																			0									
ir_akc_issue_Reference																	Reference	issue	label								AKC_Metadata	AKC_Reference																			0									
ir_akc_journal_Reference																	Reference	journal	word								AKC_Metadata	AKC_Reference																			0									
ir_akc_month_Reference																	Reference	month	word								AKC_Metadata	AKC_Reference																			0									
ir_akc_pages_Reference																	Reference	pages	label								AKC_Metadata	AKC_Reference																												
ir_akc_year_Reference																	Reference	year	integer	integer							AKC_Metadata	AKC_Reference																			0									
ir_akc_is_about_Reference																	Reference	is_about									AKC_Metadata	AKC_Reference																			0									
ir_akc_sources_Reference																	Reference	sources		uriorcurie	TRUE	"String, Array"					AKC_Metadata	AKC_Reference																			0									
ir_akc_investigations_Reference																	Reference	investigations	Class	Investigation	TRUE						AKC_Metadata	AKC_Reference																			0									
																																																								
																																																								
																																																								
																																																								
																																																								
																																																								
																																																								
ir_akc_arm_id_StudyArm																	StudyArm	arm_id	arm_id	identifier							AKC_Metadata	AKC_StudyArm																			0									
ir_akc_akc_id_StudyArm																	StudyArm	akc_id	id	identifier							AKC_Metadata	AKC_StudyArm																			0									
ir_akc_name_StudyArm																	StudyArm	name	line	string							AKC_Metadata	AKC_StudyArm																												
ir_akc_description_StudyArm																	StudyArm	description	line	string							AKC_Metadata	AKC_StudyArm																			0									
ir_akc_investigation_StudyArm																	StudyArm	investigation	Class	Investigation							AKC_Metadata	AKC_StudyArm																			0									
ir_akc_inclusion_criteria_StudyArm																	StudyArm	inclusion_criteria		string		Parse					AKC_Metadata	AKC_StudyArm																			0									
ir_akc_exclusion_criteria_StudyArm																	StudyArm	exclusion_criteria		string							AKC_Metadata	AKC_StudyArm																			0									
																																																								
ir_akc_arm_description_StudyArm																	StudyArm	arm_description	line	string							AKC_Metadata	AKC_StudyArm																			0									
ir_akc_inclusion_exclusion_criteria_arm																	arm	inclusion_exclusion_criteria									AKC_Metadata	AKC_arm																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_unique_id_arm_study_event																	arm_study_event	unique_id	word	primary							AKC_Metadata	AKC_arm_study_event																			0									
																																																								
																																																								
																																																								
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_study_arms_StudyEvent																	StudyEvent	study_arms	Class	StudyArm	TRUE						AKC_Metadata	AKC_StudyEvent																			0									
ir_akc_investigation_id_StudyEvent																	StudyEvent	investigation_id	Class	Investigation	TRUE						AKC_Metadata	AKC_StudyEvent																			0									
ir_akc_study_event_id_StudyEvent																	StudyEvent	study_event_id	study_event_id	identifier							AKC_Metadata	AKC_StudyEvent																			0									
ir_akc_life_event_type_StudyEvent																	StudyEvent	life_event_type	label								AKC_Metadata	AKC_StudyEvent																			0									
ir_akc_life_event_subtype_study_event																	study_event	life_event_subtype	label								AKC_Metadata	AKC_study_event																			0									
ir_akc_is_T0_study_event																	study_event	is_T0	boolean								AKC_Metadata	AKC_study_event																												
ir_akc_min_start_study_event																	study_event	min_start	integer								AKC_Metadata	AKC_study_event																			0									
ir_akc_max_start_study_event																	study_event	max_start	integer								AKC_Metadata	AKC_study_event																			0									
ir_akc_end_study_event																	study_event	end	integer								AKC_Metadata	AKC_study_event																			0									
																																																								
ir_akc_start_rule_study_event																	study_event	start_rule	label								AKC_Metadata	AKC_study_event																			0									
ir_akc_end_rule_study_event																	study_event	end_rule	label								AKC_Metadata	AKC_study_event																			0									
																																																								
																																																								
																																																								
																																																								
																																																								
																																																								
																																																								
																																																								
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_akc_id_Participant																	Participant	akc_id	id	identifier							AKC_Metadata	AKC_Participant																			0									
ir_akc_name_Participant																	Participant	name	line	string							AKC_Metadata	AKC_Participant																			0									
ir_akc_description_Participant																	Participant	description	line	string							AKC_Metadata	AKC_Participant																			0									
ir_akc_participant_id_Participant																	Participant	participant_id	word								AKC_Metadata	AKC_Participant																												
ir_akc_subject_id_Participant																	Participant	subject_id		string							AKC_Metadata	AKC_Participant																			0									
ir_akc_study_arm_Participant																	Participant	study_arm	Class	StudyArm							AKC_Metadata	AKC_Participant																			0									
ir_akc_species_Participant																	Participant	species	enum	Species		"Ontology, Enum"					AKC_Metadata	AKC_Participant																			0									
																																																								
ir_akc_biological_sex_Participant																	Participant	biological_sex	enum	BiologicalSex		"Enum, Enum"					AKC_Metadata	AKC_Participant																			0									
ir_akc_age_Participant																	Participant	age	word	positive number							AKC_Metadata	AKC_Participant																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_age_unit_Participant																	Participant	age_unit	word								AKC_Metadata	AKC_Participant																			0									
																																																								
ir_akc_linked_participant_Participant																	Participant	linked_participant	word								AKC_Metadata	AKC_Participant																			0									
ir_akc_link_type_Participant																	Participant	link_type	word								AKC_Metadata	AKC_Participant																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_race_Participant																	Participant	race	word	Race		"String, Object"					AKC_Metadata	AKC_Participant																			0									
ir_akc_race_specify_Participant																	Participant	race_specify	label								AKC_Metadata	AKC_Participant																												
																																																								
ir_akc_geolocation_Participant																	Participant	geolocation	GAZ:00000448	Geolocation		"String, Object"					AKC_Metadata	AKC_Participant																			0									
																																																								
																																																								
																																																								
																																																								
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_id_LifeEvent																	LifeEvent	id	word	uriorcurie							AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_name_LifeEvent																	LifeEvent	name		string							AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_description_LifeEvent																	LifeEvent	description		string							AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_participant_LifeEvent																	LifeEvent	participant	Class	Participant							AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_group_id_LifeEvent																	LifeEvent	group_id	label								AKC_Metadata	AKC_LifeEvent																												
ir_akc_study_event_LifeEvent																	LifeEvent	study_event	Class	StudyEvent							AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_investigation_id_LifeEvent																	LifeEvent	investigation_id	word								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_life_event_type_LifeEvent																	LifeEvent	life_event_type	enum	LifeEventProcess							AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_geolocation_LifeEvent																	LifeEvent	geolocation	label								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_t0_event_LifeEvent																	LifeEvent	t0_event	label								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_t0_event_LifeEvent																	LifeEvent	t0_event	label								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_t0_event_LifeEvent																	LifeEvent	t0_event	label								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_t0_event_type_LifeEvent																	LifeEvent	t0_event_type	label								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_start_LifeEvent																	LifeEvent	start	integer								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_start_LifeEvent																	LifeEvent	start	integer								AKC_Metadata	AKC_LifeEvent																			0									
ir_akc_duration_LifeEvent																	LifeEvent	duration	label								AKC_Metadata	AKC_LifeEvent																			0									
																																																								
																																																								
ir_akc_datatype_																		datatype	label																																					
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_life_event_ImmuneExposure																	ImmuneExposure	life_event	Class	LifeEvent							AKC_Metadata	AKC_ImmuneExposure																			0									
ir_akc_exposure_material_ImmuneExposure																	ImmuneExposure	exposure_material	label								AKC_Metadata	AKC_ImmuneExposure																			0									
																																																								
																																																								
ir_akc_disease_severity_ImmuneExposure																	ImmuneExposure	disease_severity	label	TODO: DiseaseSeverity							AKC_Metadata	AKC_ImmuneExposure																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_assessment_id_Assessment																	Assessment	assessment_id	word	identifier							AKC_Metadata	AKC_Assessment																			0									
ir_akc_life_event_Assessment																	Assessment	life_event	Class	LifeEvent							AKC_Metadata	AKC_Assessment																			0									
ir_akc_assessment_type_Assessment																	Assessment	assessment_type	label	TODO: AssessmentType							AKC_Metadata	AKC_Assessment																			0									
ir_akc_assessment_subtype_Assessment																	Assessment	assessment_subtype	label								AKC_Metadata	AKC_Assessment																			0									
ir_akc_target_entity_type_Assessment																	Assessment	target_entity_type	label	TODO: AssessmentTarget							AKC_Metadata	AKC_Assessment																												
																																																								
																																																								
ir_akc_unit_Assessment																	Assessment	unit	label	TODO: MeasurementUnit							AKC_Metadata	AKC_Assessment																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_specimen_id_Specimen																	Specimen	specimen_id	word	identifier							AKC_Metadata	AKC_Specimen																			0									
ir_akc_akc_id_Specimen																	Specimen	akc_id									AKC_Metadata	AKC_Specimen																												
ir_akc_name_Specimen																	Specimen	name									AKC_Metadata	AKC_Specimen																			0									
ir_akc_description_Specimen																	Specimen	description									AKC_Metadata	AKC_Specimen																			0									
ir_akc_life_event_Specimen																	Specimen	life_event	Class	LifeEvent							AKC_Metadata	AKC_Specimen																			0									
ir_akc_specimen_type_Specimen																	Specimen	specimen_type	line								AKC_Metadata	AKC_Specimen																			0									
ir_akc_tissue_Specimen																	Specimen	tissue	label			"Ontology, string"					AKC_Metadata	AKC_Specimen																			0									
ir_akc_process_Specimen																	Specimen	process	label			"string, Object"					AKC_Metadata	AKC_Specimen																			0									
ir_akc_input_specimen_id_Specimen																	Specimen	input_specimen_id		Specimen							AKC_Metadata	AKC_Specimen																												
																																																								
																																																								
ir_akc_biomaterial_provider_Specimen																	Specimen	biomaterial_provider									AKC_Metadata	AKC_Specimen																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_akc_id_AKObject																	AKObject	akc_id									AKC_Metadata	AKC_AKObject																			0									
ir_akc_name_NamedThing																	NamedThing	name									AKC_Metadata	AKC_NamedThing																												
ir_akc_description_NamedThing																	NamedThing	description									AKC_Metadata	AKC_NamedThing																			0									
ir_akc_assay_id_Assay																	Assay	assay_id	word	identifier							AKC_Metadata	AKC_Assay																			0									
ir_akc_specimen_Assay																	Assay	specimen	Class	Specimen							AKC_Metadata	AKC_Assay																			0									
																																																								
ir_akc_type_Assay																	Assay	type	label	TODO: AssayType							AKC_Metadata	AKC_Assay																			0									
ir_akc_assay_subtype_assay																	assay	assay_subtype	label								AKC_Metadata	AKC_assay																			0									
ir_akc_target_entity_type_Assay																	Assay	target_entity_type	label	TODO: AssayTargetType							AKC_Metadata	AKC_Assay																												
ir_akc_specimen_processing_Assay																	Assay	specimen_processing	Class	Processing							AKC_Metadata	AKC_Assay																			0									
																																																								
																																																								
ir_akc_epitope_TCellReceptorEpitopeBindingAssay																	TCellReceptorEpitopeBindingAssay	epitope	Class	Epitope							AKC_Metadata	AKC_TCellReceptorEpitopeBindingAssay																			0									
ir_akc_tcell_receptors_TCellReceptorEpitopeBindingAssay																	TCellReceptorEpitopeBindingAssay	tcell_receptors	Class	TCellReceptor	TRUE						AKC_Metadata	AKC_TCellReceptorEpitopeBindingAssay																			0									
ir_akc_value_TCellReceptorEpitopeBindingAssay																	TCellReceptorEpitopeBindingAssay	value	label								AKC_Metadata	AKC_TCellReceptorEpitopeBindingAssay																			0									
ir_akc_unit_TCellReceptorEpitopeBindingAssay																	TCellReceptorEpitopeBindingAssay	unit	label	TODO: MeasurementUnit							AKC_Metadata	AKC_TCellReceptorEpitopeBindingAssay																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_specimen_ReceptorRepertoireSequencingAssay																	ReceptorRepertoireSequencingAssay	specimen	Class	Specimen							AKC_Metadata	AKC_ReceptorRepertoireSequencingAssay																			0									
ir_akc_assay_type_ReceptorRepertoireSequencingAssay																	ReceptorRepertoireSequencingAssay	assay_type	label	TODO: AssayType							AKC_Metadata	AKC_ReceptorRepertoireSequencingAssay																			0									
ir_akc_type_ReceptorRepertoireSequencingAssay																	ReceptorRepertoireSequencingAssay	type	label	TODO: AssayType							AKC_Metadata	AKC_ReceptorRepertoireSequencingAssay																			0									
ir_akc_target_entity_type_ReceptorRepertoireSequencingAssay																	ReceptorRepertoireSequencingAssay	target_entity_type	label	TODO: AssayTargetType							AKC_Metadata	AKC_ReceptorRepertoireSequencingAssay																			0									
ir_akc_specimen_processing_ReceptorRepertoireSequencingAssay																	ReceptorRepertoireSequencingAssay	specimen_processing	Class	Processing							AKC_Metadata	AKC_ReceptorRepertoireSequencingAssay																												
																																																								
																																																								
																																																								
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																																																								
																																																								
ir_akc_assessment_id_assessment_dataset																	assessment_dataset	assessment_id	word	from(assessment.assessment_id)							AKC_Metadata	AKC_assessment_dataset																			0									
ir_akc_dataset_id_assessment_dataset																	assessment_dataset	dataset_id	word	from(dataset.dataset_id)							AKC_Metadata	AKC_assessment_dataset																			0									
ir_akc_assay_id_assay_dataset																	assay_dataset	assay_id	word	from(assay.assay_id)							AKC_Metadata	AKC_assay_dataset																			0									
ir_akc_dataset_id_assay_dataset																	assay_dataset	dataset_id	word	from(dataset.dataset_id)							AKC_Metadata	AKC_assay_dataset																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_specimen_SpecimenProcessing																	SpecimenProcessing	specimen	Class	Specimen							AKC_Metadata	AKC_SpecimenProcessing																			0									
																																																								
																																																								
																																																								
ir_akc_cell_subset_CellIsolationProcessing																	CellIsolationProcessing	cell_subset	Enum								AKC_Metadata	AKC_CellIsolationProcessing																			0									
ir_akc_cell_phenotype_CellIsolationProcessing																	CellIsolationProcessing	cell_phenotype	Enum								AKC_Metadata	AKC_CellIsolationProcessing																												
ir_akc_cell_species_CellIsolationProcessing																	CellIsolationProcessing	cell_species	boolean								AKC_Metadata	AKC_CellIsolationProcessing																			0									
ir_akc_single_cell_CellIsolationProcessing																	CellIsolationProcessing	single_cell	string								AKC_Metadata	AKC_CellIsolationProcessing																			0									
ir_akc_cell_number_CellIsolationProcessing																	CellIsolationProcessing	cell_number	integer								AKC_Metadata	AKC_CellIsolationProcessing																			0									
ir_akc_cells_per_reaction_CellIsolationProcessing																	CellIsolationProcessing	cells_per_reaction	integer								AKC_Metadata	AKC_CellIsolationProcessing																			0									
ir_akc_cell_storage_CellIsolationProcessing																	CellIsolationProcessing	cell_storage	string								AKC_Metadata	AKC_CellIsolationProcessing																			0									
ir_akc_cell_quality_CellIsolationProcessing																	CellIsolationProcessing	cell_quality	string								AKC_Metadata	AKC_CellIsolationProcessing																			0									
ir_akc_cell_isolation_CellIsolationProcessing																	CellIsolationProcessing	cell_isolation	string								AKC_Metadata	AKC_CellIsolationProcessing																												
ir_akc_cell_processing_protocol_CellIsolationProcessing																	CellIsolationProcessing	cell_processing_protocol	string								AKC_Metadata	AKC_CellIsolationProcessing																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_specimen_NucleicAcidProcessing																	NucleicAcidProcessing	specimen	Class	Specimen							AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_template_class_NucleicAcidProcessing																	NucleicAcidProcessing	template_class	Enum	string							AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_template_quality_NucleicAcidProcessing																	NucleicAcidProcessing	template_quality	label	string							AKC_Metadata	AKC_NucleicAcidProcessing																												
ir_akc_template_amount_NucleicAcidProcessing																	NucleicAcidProcessing	template_amount	number	number							AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_template_amount_unit_NucleicAcidProcessing																	NucleicAcidProcessing	template_amount_unit	unit	string							AKC_Metadata	AKC_NucleicAcidProcessing																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_specimen_LibraryPreparationProcessing																	LibraryPreparationProcessing	specimen	Class	Specimen							AKC_Metadata	AKC_LibraryPreparationProcessing																			0									
ir_akc_library_generation_method_LibraryPreparationProcessing																	LibraryPreparationProcessing	library_generation_method	Enum	string							AKC_Metadata	AKC_LibraryPreparationProcessing																			0									
ir_akc_library_generation_protocol_LibraryPreparationProcessing																	LibraryPreparationProcessing	library_generation_protocol	label	string							AKC_Metadata	AKC_LibraryPreparationProcessing																			0									
ir_akc_library_generation_kit_version_LibraryPreparationProcessing																	LibraryPreparationProcessing	library_generation_kit_version	label	string							AKC_Metadata	AKC_LibraryPreparationProcessing																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_pcr_target_locus_PCRTarget																	PCRTarget	pcr_target_locus	Enum	string							AKC_Metadata	AKC_PCRTarget																			0									
ir_akc_forward_pcr_primer_target_location_PCRTarget																	PCRTarget	forward_pcr_primer_target_location		string							AKC_Metadata	AKC_PCRTarget																												
ir_akc_reverse_pcr_primer_target_location_PCRTarget																	PCRTarget	reverse_pcr_primer_target_location		string							AKC_Metadata	AKC_PCRTarget																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_template_class_NucleicAcidProcessing																	NucleicAcidProcessing	template_class	Enum	string							AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_template_quality_NucleicAcidProcessing																	NucleicAcidProcessing	template_quality	label	string							AKC_Metadata	AKC_NucleicAcidProcessing																												
ir_akc_template_amount_NucleicAcidProcessing																	NucleicAcidProcessing	template_amount	number	number							AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_template_amount_unit_NucleicAcidProcessing																	NucleicAcidProcessing	template_amount_unit	unit	string							AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_library_generation_method_NucleicAcidProcessing																	NucleicAcidProcessing	library_generation_method									AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_library_generation_protocol_NucleicAcidProcessing																	NucleicAcidProcessing	library_generation_protocol									AKC_Metadata	AKC_NucleicAcidProcessing																			0									
ir_akc_complete_sequences_NucleicAcidProcessing																	NucleicAcidProcessing	complete_sequences									AKC_Metadata	AKC_NucleicAcidProcessing																												
ir_akc_physical_linkage_NucleicAcidProcessing																	NucleicAcidProcessing	physical_linkage									AKC_Metadata	AKC_NucleicAcidProcessing																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_sequencing_run_id_SequencingRun																	SequencingRun	sequencing_run_id									AKC_Metadata	AKC_SequencingRun																			0									
ir_akc_total_reads_passing_qc_filter_SequencingRun																	SequencingRun	total_reads_passing_qc_filter									AKC_Metadata	AKC_SequencingRun																			0									
ir_akc_sequencing_platform_SequencingRun																	SequencingRun	sequencing_platform									AKC_Metadata	AKC_SequencingRun																												
ir_akc_sequencing_facility_SequencingRun																	SequencingRun	sequencing_facility									AKC_Metadata	AKC_SequencingRun																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_sequencing_kit_SequencingRun																	SequencingRun	sequencing_kit									AKC_Metadata	AKC_SequencingRun																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_sequencing_data_id_SequencingData																	SequencingData	sequencing_data_id									AKC_Metadata	AKC_SequencingData																			0									
ir_akc_file_type_SequencingData																	SequencingData	file_type									AKC_Metadata	AKC_SequencingData																			0									
ir_akc_filename_SequencingData																	SequencingData	filename									AKC_Metadata	AKC_SequencingData																			0									
ir_akc_read_direction_SequencingData																	SequencingData	read_direction									AKC_Metadata	AKC_SequencingData																												
ir_akc_read_length_SequencingData																	SequencingData	read_length									AKC_Metadata	AKC_SequencingData																			0									
ir_akc_paired_filename_SequencingData																	SequencingData	paired_filename									AKC_Metadata	AKC_SequencingData																			0									
ir_akc_paired_read_direction_SequencingData																	SequencingData	paired_read_direction									AKC_Metadata	AKC_SequencingData																			0									
ir_akc_paired_read_length_SequencingData																	SequencingData	paired_read_length									AKC_Metadata	AKC_SequencingData																			0									
ir_akc_index_filename_SequencingData																	SequencingData	index_filename									AKC_Metadata	AKC_SequencingData																												
ir_akc_index_length_SequencingData																	SequencingData	index_length									AKC_Metadata	AKC_SequencingData																			0									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_akc_data_processing_id_DataProcessing																	DataProcessing	data_processing_id									AKC_Metadata	AKC_DataProcessing																												
ir_akc_primary_annotation_DataProcessing																	DataProcessing	primary_annotation									AKC_Metadata	AKC_DataProcessing																			0									
ir_akc_software_versions_DataProcessing																	DataProcessing	software_versions									AKC_Metadata	AKC_DataProcessing																			0									
ir_akc_paired_reads_assembly_DataProcessing																	DataProcessing	paired_reads_assembly									AKC_Metadata	AKC_DataProcessing																			0									
ir_akc_quality_thresholds_DataProcessing																	DataProcessing	quality_thresholds									AKC_Metadata	AKC_DataProcessing																			0									
ir_akc_primer_match_cutoffs_DataProcessing																	DataProcessing	primer_match_cutoffs									AKC_Metadata	AKC_DataProcessing																			0									
ir_akc_collapsing_method_DataProcessing																	DataProcessing	collapsing_method									AKC_Metadata	AKC_DataProcessing																			0									
ir_akc_data_processing_protocols_DataProcessing																	DataProcessing	data_processing_protocols									AKC_Metadata	AKC_DataProcessing																												
ir_akc_data_processing_files_DataProcessing																	DataProcessing	data_processing_files									AKC_Metadata	AKC_DataProcessing																			0									
																																																								
rearrangement_id	Sequence ID	Sequence ID		sequence_id	string	FALSE	FALSE																sequence_id		TRUE	TRUE	Rearrangement	Rearrangement	sequence_id	sequence_id	FALSE	string	"Unique query sequence identifier for the Rearrangement. Most often this will be the input sequence header or a substring thereof, but may also be a custom identifier defined by the tool in cases where query sequences have been combined in some fashion prior to alignment. When downloaded from an AIRR Data Commons repository, this will usually be a universally unique record locator for linking with other objects in the AIRR Data Model."			TRUE	TRUE										sequence_id				sequence_id	string	sequence_id			
sequence	Sequence	Sequence		sequence	string	FALSE	FALSE	1_Summary.txt	Sequence	FALSE	sequence	readSequence	targetSequences	rearrangement		rearrangement							sequence		TRUE	TRUE	Rearrangement	Rearrangement	sequence	sequence	FALSE	string	"The query nucleotide sequence. Usually, this is the unmodified input sequence, which may be reverse complemented if necessary. In some cases, this field may contain consensus sequences or other types of collapsed input sequences if these steps are performed prior to alignment."														sequence				sequence	string	sequence			
quality	Quality	Quality		quality	string	FALSE	FALSE				quality												quality		TRUE	FALSE	Rearrangement	Rearrangement	quality	quality	FALSE	string	The Sanger/Phred quality scores for assessment of sequence quality. Phred quality scores from 0 to 93 are encoded using ASCII 33 to 126 (Used by Illumina from v1.8.)														quality				quality	string	quality			
sequence_aa	Sequence AA	Sequence AA		sequence_aa	string	FALSE	FALSE				sequence_aa												sequence_aa		TRUE	FALSE	Rearrangement	Rearrangement	sequence_aa	sequence_aa	FALSE	string	Amino acid translation of the query nucleotide sequence.														sequence_aa				sequence_aa	string	sequence_aa			
rev_comp	Rev Comp	Rev Comp		rev_comp	boolean	FALSE	FALSE	1_Summary.txt	Orientation	TRUE	rev_comp												rev_comp		TRUE	TRUE	Rearrangement	Rearrangement	rev_comp	rev_comp	FALSE	boolean	"True if the alignment is on the opposite strand (reverse complemented) with respect to the query sequence. If True then all output data, such as alignment coordinates and sequences, are based on the reverse complement of 'sequence'."														rev_comp				rev_comp	boolean	rev_comp			
productive	Productive	Productive		productive	boolean	FALSE	FALSE	1_Summary.txt	V-DOMAIN Functionality	TRUE	productive			frame_type	productive	frame_type							productive		TRUE	TRUE	Rearrangement	Rearrangement	productive	productive	FALSE	boolean	True if the V(D)J sequence is predicted to be productive.			TRUE											functional	TRUE	functional	boolean	functional	boolean	functional			
vj_in_frame	Vj In Frame	Vj In Frame		vj_in_frame	boolean	FALSE	FALSE	1_Summary.txt	JUNCTION frame	TRUE	vj_in_frame												vj_in_frame		TRUE	FALSE	Rearrangement	Rearrangement	vj_in_frame	vj_in_frame	FALSE	boolean	True if the V and J gene alignments are in-frame.														vj_in_frame				vj_in_frame	boolean	vj_in_frame			
stop_codon	Stop Codon	Stop Codon		stop_codon	boolean	FALSE	FALSE	4_IMGT-gapped-AA-sequences.txt	V-D-J-REGION or V-J-REGION	TRUE	stop_codon												stop_codon		TRUE	FALSE	Rearrangement	Rearrangement	stop_codon	stop_codon	FALSE	boolean	True if the aligned sequence contains a stop codon.														stop_codon				stop_codon	boolean	stop_codon			
complete_vdj	Complete Vdj	Complete Vdj		complete_vdj	boolean	FALSE	FALSE				complete_vdj				full_length								complete_vdj		TRUE	FALSE	Rearrangement	Rearrangement	complete_vdj	complete_vdj	FALSE	boolean	"True if the sequence alignment spans the entire V(D)J region. Meaning, sequence_alignment includes both the first V gene codon that encodes the mature polypeptide chain (i.e., after the leader sequence) and the last complete codon of the J gene (i.e., before the J-C splice site). This does not require an absence of deletions within the internal FWR and CDR regions of the alignment."														complete_vdj				complete_vdj	boolean	complete_vdj			
locus	Gene Locus	Gene Locus		locus	string	FALSE	FALSE			TRUE	locus				chain								locus	Gene locus	TRUE	FALSE	Rearrangement	Rearrangement	locus	locus	FALSE	string	"Gene locus (chain type). Note that this field uses a controlled vocabulary that is meant to provide a generic classification of the locus, not necessarily the correct designation according to a specific nomenclature."	Gene locus	TRUE	TRUE		IGH				controlled_vocabulary				"IGH,IGI,IGK,IGL,TRA,TRB,TRD,TRG,null"	locus				locus	string	locus			
v_call	V Gene With Allele	V Gene With Allele		v_call	string	FALSE	FALSE	1_Summary.txt	V-GENE and allele	FALSE	v_call	bestVHit	bestVHit		v_gene	v_resolved							v_call	V gene with allele	TRUE	TRUE	Rearrangement	Rearrangement	v_call	v_call	FALSE	string	"V gene with allele. If referring to a known reference sequence in a database the relevant gene/allele nomenclature should be followed (e.g., IGHV4-59*01 if using IMGT/GENE-DB)."	V gene with allele	TRUE	TRUE		IGHV4-59*01	TRUE	6	data (processed sequence)						v_call	TRUE	v_call	string	v_call	string	v_call			
d_call	D Gene With Allele	D Gene With Allele		d_call	string	FALSE	FALSE	1_Summary.txt	D-GENE and allele	FALSE	d_call	bestDHit	bestDHit		d_gene	d_resolved							d_call	D gene with allele	TRUE	TRUE	Rearrangement	Rearrangement	d_call	d_call	FALSE	string	"First or only D gene with allele. If referring to a known reference sequence in a database the relevant gene/allele nomenclature should be followed (e.g., IGHD3-10*01 if using IMGT/GENE-DB)."	D gene with allele	TRUE	TRUE		IGHD3-10*01	TRUE	6	data (processed sequence)						d_call	TRUE	d_call	string	d_call	string	d_call			
d2_call	D2 Call	D2 Call		d2_call	string	FALSE	FALSE				d2_call												d2_call		TRUE	FALSE	Rearrangement	Rearrangement	d2_call	d2_call	FALSE	string	"Second D gene with allele. If referring to a known reference sequence in a database the relevant gene/allele nomenclature should be followed (e.g., IGHD3-10*01 if using IMGT/GENE-DB)."					IGHD3-10*01									d2_call				d2_call	string	d2_call			
j_call	J Gene With Allele	J Gene With Allele		j_call	string	FALSE	FALSE	1_Summary.txt	J-GENE and allele	FALSE	j_call	bestJHit	bestJHit		j_gene	j_resolved							j_call	J gene with allele	TRUE	TRUE	Rearrangement	Rearrangement	j_call	j_call	FALSE	string	"J gene with allele. If referring to a known reference sequence in a database the relevant gene/allele nomenclature should be followed (e.g., IGHJ4*02 if using IMGT/GENE-DB)."	J gene with allele	TRUE	TRUE		IGHJ4*02	TRUE	6	data (processed sequence)						j_call	TRUE	j_call	string	j_call	string	j_call			
c_call	C Region	C Region		c_call	string	FALSE	FALSE				c_call				c_gene								c_call	C region	TRUE	FALSE	Rearrangement	Rearrangement	c_call	c_call	FALSE	string	"Constant region gene with allele. If referring to a known reference sequence in a database the relevant gene/allele nomenclature should be followed (e.g., IGHG1*01 if using IMGT/GENE-DB)."	C region	TRUE	TRUE		IGHG1*01	TRUE	6	data (processed sequence)						c_call	TRUE	c_call	string	c_call	string	c_call			
sequence_alignment	Sequence Alignment	Sequence Alignment		sequence_alignment	string	FALSE	FALSE	2_IMGT-gapped-nt-sequences.txt	V-D-J-REGION or V-J-REGION	TRUE	sequence_alignment												sequence_alignment		TRUE	TRUE	Rearrangement	Rearrangement	sequence_alignment	sequence_alignment	FALSE	string	"Aligned portion of query sequence, including any indel corrections or numbering spacers, such as IMGT-gaps. Typically, this will include only the V(D)J region, but that is not a requirement."														sequence_alignment				sequence_alignment	string	sequence_alignment			
quality_alignment	Quality Alignment	Quality Alignment		quality_alignment	string	FALSE	FALSE	4_IMGT-gapped-AA-sequences.txt	V-D-J-REGION or V-J-REGION	TRUE	quality_alignment												quality_alignment		TRUE	FALSE	Rearrangement	Rearrangement	quality_alignment	quality_alignment	FALSE	string	Sanger/Phred quality scores for assessment of sequence_alignment quality. Phred quality scores from 0 to 93 are encoded using ASCII 33 to 126 (Used by Illumina from v1.8.)														quality_alignment				quality_alignment	string	quality_alignment			
sequence_alignment_aa	Sequence Alignment AA	Sequence Alignment AA		sequence_alignment_aa	string	FALSE	FALSE	4_IMGT-gapped-AA-sequences.txt	V-D-J-REGION or V-J-REGION	TRUE	sequence_alignment_aa												sequence_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	sequence_alignment_aa	sequence_alignment_aa	FALSE	string	Amino acid translation of the aligned query sequence.														sequence_alignment_aa				sequence_alignment_aa	string	sequence_alignment_aa			
germline_alignment	Germline Alignment	Germline Alignment		germline_alignment	string	FALSE	FALSE				germline_alignment												germline_alignment		TRUE	TRUE	Rearrangement	Rearrangement	germline_alignment	germline_alignment	FALSE	string	"Assembled, aligned, full-length inferred germline sequence spanning the same region as the sequence_alignment field (typically the V(D)J region) and including the same set of corrections and spacers (if any)."														germline_alignment				germline_alignment	string	germline_alignment			
germline_alignment_aa	Germline Alignment AA	Germline Alignment AA		germline_alignment_aa	string	FALSE	FALSE				germline_alignment_aa												germline_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	germline_alignment_aa	germline_alignment_aa	FALSE	string	Amino acid translation of the assembled germline sequence.														germline_alignment_aa				germline_alignment_aa	string	germline_alignment_aa			
junction	Imgt-Junction Nucleotide Sequence	Junction/CDR3 NT		junction	string	FALSE	FALSE	3_Nt-sequences.txt	JUNCTION	FALSE	junction	nSeqCDR3	nSeqCDR3		cdr3_nt								junction	IMGT-JUNCTION nucleotide sequence	TRUE	TRUE	Rearrangement	Rearrangement	junction	junction	FALSE	string	"Junction region nucleotide sequence, where the junction is defined as the CDR3 plus the two flanking conserved codons."	IMGT-JUNCTION nucleotide sequence	TRUE			TGTGCAAGAGCGGGAGTTTACGACGGATATACTATGGACTACTGG	TRUE	6	data (processed sequence)						junction				junction	string	junction			
junction_aa	Imgt-Junction Amino Acid Sequence	Junction/CDR3 AA		junction_aa	string	FALSE	FALSE	5_AA-sequences.txt	JUNCTION	FALSE	junction_aa	aaSeqCDR3	aaSeqCDR3	amino_acid	cdr3	amino_acid							junction_aa	IMGT-JUNCTION amino acid sequence	TRUE	TRUE	Rearrangement	Rearrangement	junction_aa	junction_aa	FALSE	string	Amino acid translation of the junction.	IMGT-JUNCTION amino acid sequence	TRUE	TRUE		CARAGVYDGYTMDYW	TRUE	6	data (processed sequence)						junction_aa	TRUE	junction_aa	string	junction_aa	string	junction_aa			
np1	Np1	Np1		np1	string	FALSE	FALSE	6_Junction.txt	P3'V or N-REGION or N1-REGION or P5'D or P5'D1 or P5'J	TRUE	np1												np1		TRUE	FALSE	Rearrangement	Rearrangement	np1	np1	FALSE	string	Nucleotide sequence of the combined N/P region between the V gene and first D gene alignment or between the V gene and J gene alignments.														np1				np1	string	np1			
np1_aa	Np1 AA	Np1 AA		np1_aa	string	FALSE	FALSE	6_Junction.txt		TRUE	np1_aa												np1_aa		TRUE	FALSE	Rearrangement	Rearrangement	np1_aa	np1_aa	FALSE	string	Amino acid translation of the np1 field.														np1_aa				np1_aa	string	np1_aa			
np2	Np2	Np2		np2	string	FALSE	FALSE	6_Junction.txt	P3'D or P3'D1 or N2-REGION or P5'J or P5'D2	TRUE	np2												np2		TRUE	FALSE	Rearrangement	Rearrangement	np2	np2	FALSE	string	Nucleotide sequence of the combined N/P region between either the first D gene and J gene alignments or the first D gene and second D gene alignments.														np2				np2	string	np2			
np2_aa	Np2 AA	Np2 AA		np2_aa	string	FALSE	FALSE	6_Junction.txt		TRUE	np2_aa												np2_aa		TRUE	FALSE	Rearrangement	Rearrangement	np2_aa	np2_aa	FALSE	string	Amino acid translation of the np2 field.														np2_aa				np2_aa	string	np2_aa			
np3	Np3	Np3		np3	string	FALSE	FALSE				np3												np3		TRUE	FALSE	Rearrangement	Rearrangement	np3	np3	FALSE	string	Nucleotide sequence of the combined N/P region between the second D gene and J gene alignments.														np3				np3	string	np3			
np3_aa	Np3 AA	Np3 AA		np3_aa	string	FALSE	FALSE				np3_aa												np3_aa		TRUE	FALSE	Rearrangement	Rearrangement	np3_aa	np3_aa	FALSE	string	Amino acid translation of the np3 field.														np3_aa				np3_aa	string	np3_aa			
cdr1	CDR1	CDR1		cdr1	string	FALSE	FALSE	3_Nt-sequences.txt	CDR1-IMGT	FALSE	cdr1			cdr1_rearrangement	cdr1_nt								cdr1		TRUE	FALSE	Rearrangement	Rearrangement	cdr1	cdr1	FALSE	string	Nucleotide sequence of the aligned CDR1 region.														cdr1				cdr1	string	cdr1			
cdr1_aa	CDR1 AA	CDR1 AA		cdr1_aa	string	FALSE	FALSE	5_AA-sequences.txt	CDR1-IMGT	FALSE	cdr1_aa			cdr1_amino_acid	cdr1								cdr1_aa		TRUE	FALSE	Rearrangement	Rearrangement	cdr1_aa	cdr1_aa	FALSE	string	Amino acid translation of the cdr1 field.														cdr1_aa				cdr1_aa	string	cdr1_aa			
cdr2	CDR2	CDR2		cdr2	string	FALSE	FALSE	3_Nt-sequences.txt	CDR2-IMGT	FALSE	cdr2			cdr2_rearrangement	cdr2_nt								cdr2		TRUE	FALSE	Rearrangement	Rearrangement	cdr2	cdr2	FALSE	string	Nucleotide sequence of the aligned CDR2 region.														cdr2				cdr2	string	cdr2			
cdr2_aa	CDR2 AA	CDR2 AA		cdr2_aa	string	FALSE	FALSE	5_AA-sequences.txt	CDR2-IMGT	FALSE	cdr2_aa			cdr2_amino_acid	cdr2								cdr2_aa		TRUE	FALSE	Rearrangement	Rearrangement	cdr2_aa	cdr2_aa	FALSE	string	Amino acid translation of the cdr2 field.														cdr2_aa				cdr2_aa	string	cdr2_aa			
cdr3	CDR3	CDR3		cdr3	string	FALSE	FALSE	3_Nt-sequences.txt	CDR3-IMGT	FALSE	cdr3			cdr3_rearrangement									cdr3		TRUE	FALSE	Rearrangement	Rearrangement	cdr3	cdr3	FALSE	string	Nucleotide sequence of the aligned CDR3 region.														cdr3				cdr3	string	cdr3			
cdr3_aa	CDR3 AA	CDR3 AA		cdr3_aa	string	FALSE	FALSE	5_AA-sequences.txt	CDR3-IMGT	FALSE	cdr3_aa			cdr3_amino_acid									cdr3_aa		TRUE	FALSE	Rearrangement	Rearrangement	cdr3_aa	cdr3_aa	FALSE	string	Amino acid translation of the cdr3 field.														cdr3_aa				cdr3_aa	string	cdr3_aa			
fwr1	FWR1	FWR1		fwr1	string	FALSE	FALSE	3_Nt-sequences.txt	FR1-IMGT	FALSE	fwr1				fwr1_nt								fwr1		TRUE	FALSE	Rearrangement	Rearrangement	fwr1	fwr1	FALSE	string	Nucleotide sequence of the aligned FWR1 region.														fwr1				fwr1	string	fwr1			
fwr1_aa	FWR1 AA	FWR1 AA		fwr1_aa	string	FALSE	FALSE	5_AA-sequences.txt	FR1-IMGT	FALSE	fwr1_aa				fwr1								fwr1_aa		TRUE	FALSE	Rearrangement	Rearrangement	fwr1_aa	fwr1_aa	FALSE	string	Amino acid translation of the fwr1 field.														fwr1_aa				fwr1_aa	string	fwr1_aa			
fwr2	FWR2	FWR2		fwr2	string	FALSE	FALSE	3_Nt-sequences.txt	FR2-IMGT	FALSE	fwr2				fwr2_nt								fwr2		TRUE	FALSE	Rearrangement	Rearrangement	fwr2	fwr2	FALSE	string	Nucleotide sequence of the aligned FWR2 region.														fwr2				fwr2	string	fwr2			
fwr2_aa	FWR2 AA	FWR2 AA		fwr2_aa	string	FALSE	FALSE	5_AA-sequences.txt	FR2-IMGT	FALSE	fwr2_aa				fwr2								fwr2_aa		TRUE	FALSE	Rearrangement	Rearrangement	fwr2_aa	fwr2_aa	FALSE	string	Amino acid translation of the fwr2 field.														fwr2_aa				fwr2_aa	string	fwr2_aa			
fwr3	FWR3	FWR3		fwr3	string	FALSE	FALSE	3_Nt-sequences.txt	FR3-IMGT	FALSE	fwr3				fwr3_nt								fwr3		TRUE	FALSE	Rearrangement	Rearrangement	fwr3	fwr3	FALSE	string	Nucleotide sequence of the aligned FWR3 region.														fwr3				fwr3	string	fwr3			
fwr3_aa	FWR3 AA	FWR3 AA		fwr3_aa	string	FALSE	FALSE	5_AA-sequences.txt	FR3-IMGT	FALSE	fwr3_aa				fwr3								fwr3_aa		TRUE	FALSE	Rearrangement	Rearrangement	fwr3_aa	fwr3_aa	FALSE	string	Amino acid translation of the fwr3 field.														fwr3_aa				fwr3_aa	string	fwr3_aa			
fwr4	FWR4	FWR4		fwr4	string	FALSE	FALSE	3_Nt-sequences.txt	FR4-IMGT	FALSE	fwr4				fwr4_nt								fwr4		TRUE	FALSE	Rearrangement	Rearrangement	fwr4	fwr4	FALSE	string	Nucleotide sequence of the aligned FWR4 region.														fwr4				fwr4	string	fwr4			
fwr4_aa	FWR4 AA	FWR4 AA		fwr4_aa	string	FALSE	FALSE	5_AA-sequences.txt	FR4-IMGT	FALSE	fwr4_aa				fwr4								fwr4_aa		TRUE	FALSE	Rearrangement	Rearrangement	fwr4_aa	fwr4_aa	FALSE	string	Amino acid translation of the fwr4 field.														fwr4_aa				fwr4_aa	string	fwr4_aa			
v_score	V Score	V Score		v_score	number	FALSE	FALSE	1_Summary.txt	V-REGION score	FALSE	v_score	bestVHitScore	bestVHitScore										v_score		TRUE	FALSE	Rearrangement	Rearrangement	v_score	v_score	FALSE	number	Alignment score for the V gene.														v_score				v_score	number	v_score			
v_identity	V IDentity	V IDentity		v_identity	number	FALSE	FALSE	1_Summary.txt	V-REGION identity %	FALSE	v_identity												v_identity		TRUE	FALSE	Rearrangement	Rearrangement	v_identity	v_identity	FALSE	number	Fractional identity for the V gene alignment.														v_identity				v_identity	number	v_identity			
v_support	V Support	V Support		v_support	number	FALSE	FALSE				v_support												v_support		TRUE	FALSE	Rearrangement	Rearrangement	v_support	v_support	FALSE	number	"V gene alignment E-value, p-value, likelihood, probability or other similar measure of support for the V gene assignment as defined by the alignment tool."														v_support				v_support	number	v_support			
v_cigar	V Cigar	V Cigar		v_cigar	string	FALSE	FALSE				v_cigar												v_cigar		TRUE	TRUE	Rearrangement	Rearrangement	v_cigar	v_cigar	FALSE	string	CIGAR string for the V gene alignment.														v_cigar				v_cigar	string	v_cigar			
d_score	D Score	D Score		d_score	number	FALSE	FALSE				d_score	bestDHitScore	bestDHitScore										d_score		TRUE	FALSE	Rearrangement	Rearrangement	d_score	d_score	FALSE	number	Alignment score for the first or only D gene alignment.														d_score				d_score	number	d_score			
d_identity	D IDentity	D IDentity		d_identity	number	FALSE	FALSE				d_identity												d_identity		TRUE	FALSE	Rearrangement	Rearrangement	d_identity	d_identity	FALSE	number	Fractional identity for the first or only D gene alignment.														d_identity				d_identity	number	d_identity			
d_support	D Support	D Support		d_support	number	FALSE	FALSE				d_support												d_support		TRUE	FALSE	Rearrangement	Rearrangement	d_support	d_support	FALSE	number	"D gene alignment E-value, p-value, likelihood, probability or other similar measure of support for the first or only D gene as defined by the alignment tool."														d_support				d_support	number	d_support			
d_cigar	D Cigar	D Cigar		d_cigar	string	FALSE	FALSE				d_cigar												d_cigar		TRUE	TRUE	Rearrangement	Rearrangement	d_cigar	d_cigar	FALSE	string	CIGAR string for the first or only D gene alignment.														d_cigar				d_cigar	string	d_cigar			
d2_score	D2 Score	D2 Score		d2_score	number	FALSE	FALSE				d2_score												d2_score		TRUE	FALSE	Rearrangement	Rearrangement	d2_score	d2_score	FALSE	number	Alignment score for the second D gene alignment.														d2_score				d2_score	number	d2_score			
d2_identity	D2 IDentity	D2 IDentity		d2_identity	number	FALSE	FALSE				d2_identity												d2_identity		TRUE	FALSE	Rearrangement	Rearrangement	d2_identity	d2_identity	FALSE	number	Fractional identity for the second D gene alignment.														d2_identity				d2_identity	number	d2_identity			
d2_support	D2 Support	D2 Support		d2_support	number	FALSE	FALSE				d2_support												d2_support		TRUE	FALSE	Rearrangement	Rearrangement	d2_support	d2_support	FALSE	number	"D gene alignment E-value, p-value, likelihood, probability or other similar measure of support for the second D gene as defined by the alignment tool."														d2_support				d2_support	number	d2_support			
d2_cigar	D2 Cigar	D2 Cigar		d2_cigar	string	FALSE	FALSE				d2_cigar												d2_cigar		TRUE	FALSE	Rearrangement	Rearrangement	d2_cigar	d2_cigar	FALSE	string	CIGAR string for the second D gene alignment.														d2_cigar				d2_cigar	string	d2_cigar			
j_score	J Score	J Score		j_score	number	FALSE	FALSE	1_Summary.txt	J-REGION score	FALSE	j_score	bestJHitScore	bestJHitScore										j_score		TRUE	FALSE	Rearrangement	Rearrangement	j_score	j_score	FALSE	number	Alignment score for the J gene alignment.														j_score				j_score	number	j_score			
j_identity	J IDentity	J IDentity		j_identity	number	FALSE	FALSE	1_Summary.txt	J-REGION identity %	FALSE	j_identity												j_identity		TRUE	FALSE	Rearrangement	Rearrangement	j_identity	j_identity	FALSE	number	Fractional identity for the J gene alignment.														j_identity				j_identity	number	j_identity			
j_support	J Support	J Support		j_support	number	FALSE	FALSE				j_support												j_support		TRUE	FALSE	Rearrangement	Rearrangement	j_support	j_support	FALSE	number	"J gene alignment E-value, p-value, likelihood, probability or other similar measure of support for the J gene assignment as defined by the alignment tool."														j_support				j_support	number	j_support			
j_cigar	J Cigar	J Cigar		j_cigar	string	FALSE	FALSE				j_cigar												j_cigar		TRUE	TRUE	Rearrangement	Rearrangement	j_cigar	j_cigar	FALSE	string	CIGAR string for the J gene alignment.														j_cigar				j_cigar	string	j_cigar			
c_score	C Score	C Score		c_score	number	FALSE	FALSE				c_score												c_score		TRUE	FALSE	Rearrangement	Rearrangement	c_score	c_score	FALSE	number	Alignment score for the C gene alignment.														c_score				c_score	number	c_score			
c_identity	C IDentity	C IDentity		c_identity	number	FALSE	FALSE				c_identity												c_identity		TRUE	FALSE	Rearrangement	Rearrangement	c_identity	c_identity	FALSE	number	Fractional identity for the C gene alignment.														c_identity				c_identity	number	c_identity			
c_support	C Support	C Support		c_support	number	FALSE	FALSE				c_support												c_support		TRUE	FALSE	Rearrangement	Rearrangement	c_support	c_support	FALSE	number	"C gene alignment E-value, p-value, likelihood, probability or other similar measure of support for the C gene assignment as defined by the alignment tool."														c_support				c_support	number	c_support			
c_cigar	C Cigar	C Cigar		c_cigar	string	FALSE	FALSE				c_cigar												c_cigar		TRUE	FALSE	Rearrangement	Rearrangement	c_cigar	c_cigar	FALSE	string	CIGAR string for the C gene alignment.														c_cigar				c_cigar	string	c_cigar			
v_sequence_start	V Sequence Start	V Sequence Start		v_sequence_start	integer	FALSE	FALSE	3_Nt-sequences.txt	V-REGION start	FALSE	v_sequence_start												v_sequence_start		TRUE	FALSE	Rearrangement	Rearrangement	v_sequence_start	v_sequence_start	FALSE	integer	Start position of the V gene in the query sequence (1-based closed interval).														v_sequence_start				v_sequence_start	integer	v_sequence_start			
v_sequence_end	V Sequence End	V Sequence End		v_sequence_end	integer	FALSE	FALSE	3_Nt-sequences.txt	V-REGION end	FALSE	v_sequence_end												v_sequence_end		TRUE	FALSE	Rearrangement	Rearrangement	v_sequence_end	v_sequence_end	FALSE	integer	End position of the V gene in the query sequence (1-based closed interval).														v_sequence_end				v_sequence_end	integer	v_sequence_end			
v_germline_start	V Germline Start	V Germline Start		v_germline_start	integer	FALSE	FALSE				v_germline_start												v_germline_start		TRUE	FALSE	Rearrangement	Rearrangement	v_germline_start	v_germline_start	FALSE	integer	Alignment start position in the V gene reference sequence (1-based closed interval).														v_germline_start				v_germline_start	integer	v_germline_start			
v_germline_end	V Germline End	V Germline End		v_germline_end	integer	FALSE	FALSE				v_germline_end												v_germline_end		TRUE	FALSE	Rearrangement	Rearrangement	v_germline_end	v_germline_end	FALSE	integer	Alignment end position in the V gene reference sequence (1-based closed interval).														v_germline_end				v_germline_end	integer	v_germline_end			
v_alignment_start	V Alignment Start	V Alignment Start		v_alignment_start	integer	FALSE	FALSE				v_alignment_start												v_alignment_start		TRUE	FALSE	Rearrangement	Rearrangement	v_alignment_start	v_alignment_start	FALSE	integer	Start position of the V gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														v_alignment_start				v_alignment_start	integer	v_alignment_start			
v_alignment_end	V Alignment End	V Alignment End		v_alignment_end	integer	FALSE	FALSE				v_alignment_end												v_alignment_end		TRUE	FALSE	Rearrangement	Rearrangement	v_alignment_end	v_alignment_end	FALSE	integer	End position of the V gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														v_alignment_end				v_alignment_end	integer	v_alignment_end			
d_sequence_start	D Sequence Start	D Sequence Start		d_sequence_start	integer	FALSE	FALSE	3_Nt-sequences.txt	D-REGION start or D1-REGION start	TRUE	d_sequence_start												d_sequence_start		TRUE	FALSE	Rearrangement	Rearrangement	d_sequence_start	d_sequence_start	FALSE	integer	Start position of the first or only D gene in the query sequence. (1-based closed interval).														d_sequence_start				d_sequence_start	integer	d_sequence_start			
d_sequence_end	D Sequence End	D Sequence End		d_sequence_end	integer	FALSE	FALSE	3_Nt-sequences.txt	D-REGION end or D1-REGION end	TRUE	d_sequence_end												d_sequence_end		TRUE	FALSE	Rearrangement	Rearrangement	d_sequence_end	d_sequence_end	FALSE	integer	End position of the first or only D gene in the query sequence. (1-based closed interval).														d_sequence_end				d_sequence_end	integer	d_sequence_end			
d_germline_start	D Germline Start	D Germline Start		d_germline_start	integer	FALSE	FALSE				d_germline_start												d_germline_start		TRUE	FALSE	Rearrangement	Rearrangement	d_germline_start	d_germline_start	FALSE	integer	Alignment start position in the D gene reference sequence for the first or only D gene (1-based closed interval).														d_germline_start				d_germline_start	integer	d_germline_start			
d_germline_end	D Germline End	D Germline End		d_germline_end	integer	FALSE	FALSE				d_germline_end												d_germline_end		TRUE	FALSE	Rearrangement	Rearrangement	d_germline_end	d_germline_end	FALSE	integer	Alignment end position in the D gene reference sequence for the first or only D gene (1-based closed interval).														d_germline_end				d_germline_end	integer	d_germline_end			
d_alignment_start	D Alignment Start	D Alignment Start		d_alignment_start	integer	FALSE	FALSE				d_alignment_start												d_alignment_start		TRUE	FALSE	Rearrangement	Rearrangement	d_alignment_start	d_alignment_start	FALSE	integer	Start position of the first or only D gene in both the sequence_alignment and germline_alignment fields (1-based closed interval).														d_alignment_start				d_alignment_start	integer	d_alignment_start			
d_alignment_end	D Alignment End	D Alignment End		d_alignment_end	integer	FALSE	FALSE				d_alignment_end												d_alignment_end		TRUE	FALSE	Rearrangement	Rearrangement	d_alignment_end	d_alignment_end	FALSE	integer	End position of the first or only D gene in both the sequence_alignment and germline_alignment fields (1-based closed interval).														d_alignment_end				d_alignment_end	integer	d_alignment_end			
d2_sequence_start	D2 Sequence Start	D2 Sequence Start		d2_sequence_start	integer	FALSE	FALSE				d2_sequence_start												d2_sequence_start		TRUE	FALSE	Rearrangement	Rearrangement	d2_sequence_start	d2_sequence_start	FALSE	integer	Start position of the second D gene in the query sequence (1-based closed interval).														d2_sequence_start				d2_sequence_start	integer	d2_sequence_start			
d2_sequence_end	D2 Sequence End	D2 Sequence End		d2_sequence_end	integer	FALSE	FALSE				d2_sequence_end												d2_sequence_end		TRUE	FALSE	Rearrangement	Rearrangement	d2_sequence_end	d2_sequence_end	FALSE	integer	End position of the second D gene in the query sequence (1-based closed interval).														d2_sequence_end				d2_sequence_end	integer	d2_sequence_end			
d2_germline_start	D2 Germline Start	D2 Germline Start		d2_germline_start	integer	FALSE	FALSE				d2_germline_start												d2_germline_start		TRUE	FALSE	Rearrangement	Rearrangement	d2_germline_start	d2_germline_start	FALSE	integer	Alignment start position in the second D gene reference sequence (1-based closed interval).														d2_germline_start				d2_germline_start	integer	d2_germline_start			
d2_germline_end	D2 Germline End	D2 Germline End		d2_germline_end	integer	FALSE	FALSE				d2_germline_end												d2_germline_end		TRUE	FALSE	Rearrangement	Rearrangement	d2_germline_end	d2_germline_end	FALSE	integer	Alignment end position in the second D gene reference sequence (1-based closed interval).														d2_germline_end				d2_germline_end	integer	d2_germline_end			
d2_alignment_start	D2 Alignment Start	D2 Alignment Start		d2_alignment_start	integer	FALSE	FALSE				d2_alignment_start												d2_alignment_start		TRUE	FALSE	Rearrangement	Rearrangement	d2_alignment_start	d2_alignment_start	FALSE	integer	Start position of the second D gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														d2_alignment_start				d2_alignment_start	integer	d2_alignment_start			
d2_alignment_end	D2 Alignment End	D2 Alignment End		d2_alignment_end	integer	FALSE	FALSE				d2_alignment_end												d2_alignment_end		TRUE	FALSE	Rearrangement	Rearrangement	d2_alignment_end	d2_alignment_end	FALSE	integer	End position of the second D gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														d2_alignment_end				d2_alignment_end	integer	d2_alignment_end			
j_sequence_start	J Sequence Start	J Sequence Start		j_sequence_start	integer	FALSE	FALSE	3_Nt-sequences.txt	J-REGION start	FALSE	j_sequence_start												j_sequence_start		TRUE	FALSE	Rearrangement	Rearrangement	j_sequence_start	j_sequence_start	FALSE	integer	Start position of the J gene in the query sequence (1-based closed interval).														j_sequence_start				j_sequence_start	integer	j_sequence_start			
j_sequence_end	J Sequence End	J Sequence End		j_sequence_end	integer	FALSE	FALSE	3_Nt-sequences.txt	J-REGION end	FALSE	j_sequence_end												j_sequence_end		TRUE	FALSE	Rearrangement	Rearrangement	j_sequence_end	j_sequence_end	FALSE	integer	End position of the J gene in the query sequence (1-based closed interval).														j_sequence_end				j_sequence_end	integer	j_sequence_end			
j_germline_start	J Germline Start	J Germline Start		j_germline_start	integer	FALSE	FALSE				j_germline_start												j_germline_start		TRUE	FALSE	Rearrangement	Rearrangement	j_germline_start	j_germline_start	FALSE	integer	Alignment start position in the J gene reference sequence (1-based closed interval).														j_germline_start				j_germline_start	integer	j_germline_start			
j_germline_end	J Germline End	J Germline End		j_germline_end	integer	FALSE	FALSE				j_germline_end												j_germline_end		TRUE	FALSE	Rearrangement	Rearrangement	j_germline_end	j_germline_end	FALSE	integer	Alignment end position in the J gene reference sequence (1-based closed interval).														j_germline_end				j_germline_end	integer	j_germline_end			
j_alignment_start	J Alignment Start	J Alignment Start		j_alignment_start	integer	FALSE	FALSE				j_alignment_start												j_alignment_start		TRUE	FALSE	Rearrangement	Rearrangement	j_alignment_start	j_alignment_start	FALSE	integer	Start position of the J gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														j_alignment_start				j_alignment_start	integer	j_alignment_start			
j_alignment_end	J Alignment End	J Alignment End		j_alignment_end	integer	FALSE	FALSE				j_alignment_end												j_alignment_end		TRUE	FALSE	Rearrangement	Rearrangement	j_alignment_end	j_alignment_end	FALSE	integer	End position of the J gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														j_alignment_end				j_alignment_end	integer	j_alignment_end			
c_sequence_start	C Sequence Start	C Sequence Start		c_sequence_start	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR1-IMGT start	FALSE	c_sequence_start												c_sequence_start		TRUE	FALSE	Rearrangement	Rearrangement	c_sequence_start	c_sequence_start	FALSE	integer	Start position of the C gene in the query sequence (1-based closed interval).														c_sequence_start				c_sequence_start	integer	c_sequence_start			
c_sequence_end	C Sequence End	C Sequence End		c_sequence_end	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR1-IMGT end	FALSE	c_sequence_end												c_sequence_end		TRUE	FALSE	Rearrangement	Rearrangement	c_sequence_end	c_sequence_end	FALSE	integer	End position of the C gene in the query sequence (1-based closed interval).														c_sequence_end				c_sequence_end	integer	c_sequence_end			
c_germline_start	C Germline Start	C Germline Start		c_germline_start	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR2-IMGT start	FALSE	c_germline_start												c_germline_start		TRUE	FALSE	Rearrangement	Rearrangement	c_germline_start	c_germline_start	FALSE	integer	Alignment start position in the C gene reference sequence (1-based closed interval).														c_germline_start				c_germline_start	integer	c_germline_start			
c_germline_end	C Germline End	C Germline End		c_germline_end	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR2-IMGT end	FALSE	c_germline_end												c_germline_end		TRUE	FALSE	Rearrangement	Rearrangement	c_germline_end	c_germline_end	FALSE	integer	Alignment end position in the C gene reference sequence (1-based closed interval).														c_germline_end				c_germline_end	integer	c_germline_end			
c_alignment_start	C Alignment Start	C Alignment Start		c_alignment_start	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR3-IMGT start	FALSE	c_alignment_start												c_alignment_start		TRUE	FALSE	Rearrangement	Rearrangement	c_alignment_start	c_alignment_start	FALSE	integer	Start position of the C gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														c_alignment_start				c_alignment_start	integer	c_alignment_start			
c_alignment_end	C Alignment End	C Alignment End		c_alignment_end	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR3-IMGT end	FALSE	c_alignment_end												c_alignment_end		TRUE	FALSE	Rearrangement	Rearrangement	c_alignment_end	c_alignment_end	FALSE	integer	End position of the C gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														c_alignment_end				c_alignment_end	integer	c_alignment_end			
cdr1_start	CDR1 Start	CDR1 Start		cdr1_start	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR1-IMGT start	FALSE	cdr1_start			cdr1_start_index									cdr1_start		TRUE	FALSE	Rearrangement	Rearrangement	cdr1_start	cdr1_start	FALSE	integer	CDR1 start position in the query sequence (1-based closed interval).														cdr1_start				cdr1_start	integer	cdr1_start			
cdr1_end	CDR1 End	CDR1 End		cdr1_end	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR1-IMGT end	FALSE	cdr1_end												cdr1_end		TRUE	FALSE	Rearrangement	Rearrangement	cdr1_end	cdr1_end	FALSE	integer	CDR1 end position in the query sequence (1-based closed interval).														cdr1_end				cdr1_end	integer	cdr1_end			
cdr2_start	CDR2 Start	CDR2 Start		cdr2_start	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR2-IMGT start	FALSE	cdr2_start			cdr2_start_index									cdr2_start		TRUE	FALSE	Rearrangement	Rearrangement	cdr2_start	cdr2_start	FALSE	integer	CDR2 start position in the query sequence (1-based closed interval).														cdr2_start				cdr2_start	integer	cdr2_start			
cdr2_end	CDR2 End	CDR2 End		cdr2_end	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR2-IMGT end	FALSE	cdr2_end												cdr2_end		TRUE	FALSE	Rearrangement	Rearrangement	cdr2_end	cdr2_end	FALSE	integer	CDR2 end position in the query sequence (1-based closed interval).														cdr2_end				cdr2_end	integer	cdr2_end			
cdr3_start	CDR3 Start	CDR3 Start		cdr3_start	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR3-IMGT start	FALSE	cdr3_start			cdr3_start_index									cdr3_start		TRUE	FALSE	Rearrangement	Rearrangement	cdr3_start	cdr3_start	FALSE	integer	CDR3 start position in the query sequence (1-based closed interval).														cdr3_start				cdr3_start	integer	cdr3_start			
cdr3_end	CDR3 End	CDR3 End		cdr3_end	integer	FALSE	FALSE	3_Nt-sequences.txt	CDR3-IMGT end	FALSE	cdr3_end												cdr3_end		TRUE	FALSE	Rearrangement	Rearrangement	cdr3_end	cdr3_end	FALSE	integer	CDR3 end position in the query sequence (1-based closed interval).														cdr3_end				cdr3_end	integer	cdr3_end			
fwr1_start	FWR1 Start	FWR1 Start		fwr1_start	integer	FALSE	FALSE	3_Nt-sequences.txt	FR1-IMGT start	FALSE	fwr1_start												fwr1_start		TRUE	FALSE	Rearrangement	Rearrangement	fwr1_start	fwr1_start	FALSE	integer	FWR1 start position in the query sequence (1-based closed interval).														fwr1_start				fwr1_start	integer	fwr1_start			
fwr1_end	FWR1 End	FWR1 End		fwr1_end	integer	FALSE	FALSE	3_Nt-sequences.txt	FR1-IMGT end	FALSE	fwr1_end												fwr1_end		TRUE	FALSE	Rearrangement	Rearrangement	fwr1_end	fwr1_end	FALSE	integer	FWR1 end position in the query sequence (1-based closed interval).														fwr1_end				fwr1_end	integer	fwr1_end			
fwr2_start	FWR2 Start	FWR2 Start		fwr2_start	integer	FALSE	FALSE	3_Nt-sequences.txt	FR2-IMGT start	FALSE	fwr2_start												fwr2_start		TRUE	FALSE	Rearrangement	Rearrangement	fwr2_start	fwr2_start	FALSE	integer	FWR2 start position in the query sequence (1-based closed interval).														fwr2_start				fwr2_start	integer	fwr2_start			
fwr2_end	FWR2 End	FWR2 End		fwr2_end	integer	FALSE	FALSE	3_Nt-sequences.txt	FR2-IMGT end	FALSE	fwr2_end												fwr2_end		TRUE	FALSE	Rearrangement	Rearrangement	fwr2_end	fwr2_end	FALSE	integer	FWR2 end position in the query sequence (1-based closed interval).														fwr2_end				fwr2_end	integer	fwr2_end			
fwr3_start	FWR3 Start	FWR3 Start		fwr3_start	integer	FALSE	FALSE	3_Nt-sequences.txt	FR3-IMGT start	FALSE	fwr3_start												fwr3_start		TRUE	FALSE	Rearrangement	Rearrangement	fwr3_start	fwr3_start	FALSE	integer	FWR3 start position in the query sequence (1-based closed interval).														fwr3_start				fwr3_start	integer	fwr3_start			
fwr3_end	FWR3 End	FWR3 End		fwr3_end	integer	FALSE	FALSE	3_Nt-sequences.txt	FR3-IMGT end	FALSE	fwr3_end												fwr3_end		TRUE	FALSE	Rearrangement	Rearrangement	fwr3_end	fwr3_end	FALSE	integer	FWR3 end position in the query sequence (1-based closed interval).														fwr3_end				fwr3_end	integer	fwr3_end			
fwr4_start	FWR4 Start	FWR4 Start		fwr4_start	integer	FALSE	FALSE	3_Nt-sequences.txt	FR4-IMGT start	FALSE	fwr4_start												fwr4_start		TRUE	FALSE	Rearrangement	Rearrangement	fwr4_start	fwr4_start	FALSE	integer	FWR4 start position in the query sequence (1-based closed interval).														fwr4_start				fwr4_start	integer	fwr4_start			
fwr4_end	FWR4 End	FWR4 End		fwr4_end	integer	FALSE	FALSE	3_Nt-sequences.txt	FR4-IMGT end	FALSE	fwr4_end												fwr4_end		TRUE	FALSE	Rearrangement	Rearrangement	fwr4_end	fwr4_end	FALSE	integer	FWR4 end position in the query sequence (1-based closed interval).														fwr4_end				fwr4_end	integer	fwr4_end			
v_sequence_alignment	V Sequence Alignment	V Sequence Alignment		v_sequence_alignment	string	FALSE	FALSE	2_IMGT-gapped-nt-sequences.txt	V-REGION	FALSE	v_sequence_alignment												v_sequence_alignment		TRUE	FALSE	Rearrangement	Rearrangement	v_sequence_alignment	v_sequence_alignment	FALSE	string	"Aligned portion of query sequence assigned to the V gene, including any indel corrections or numbering spacers."														v_sequence_alignment				v_sequence_alignment	string	v_sequence_alignment			
v_sequence_alignment_aa	V Sequence Alignment AA	V Sequence Alignment AA		v_sequence_alignment_aa	string	FALSE	FALSE	4_IMGT-gapped-AA-sequences.txt	V-REGION	FALSE	v_sequence_alignment_aa												v_sequence_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	v_sequence_alignment_aa	v_sequence_alignment_aa	FALSE	string	Amino acid translation of the v_sequence_alignment field.														v_sequence_alignment_aa				v_sequence_alignment_aa	string	v_sequence_alignment_aa			
d_sequence_alignment	D Sequence Alignment	D Sequence Alignment		d_sequence_alignment	string	FALSE	FALSE	3_Nt-sequences.txt	D-REGION or D1-REGION	TRUE	d_sequence_alignment												d_sequence_alignment		TRUE	FALSE	Rearrangement	Rearrangement	d_sequence_alignment	d_sequence_alignment	FALSE	string	"Aligned portion of query sequence assigned to the first or only D gene, including any indel corrections or numbering spacers."														d_sequence_alignment				d_sequence_alignment	string	d_sequence_alignment			
d_sequence_alignment_aa	D Sequence Alignment AA	D Sequence Alignment AA		d_sequence_alignment_aa	string	FALSE	FALSE	4_IMGT-gapped-AA-sequences.txt		TRUE	d_sequence_alignment_aa												d_sequence_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	d_sequence_alignment_aa	d_sequence_alignment_aa	FALSE	string	Amino acid translation of the d_sequence_alignment field.														d_sequence_alignment_aa				d_sequence_alignment_aa	string	d_sequence_alignment_aa			
d2_sequence_alignment	D2 Sequence Alignment	D2 Sequence Alignment		d2_sequence_alignment	string	FALSE	FALSE				d2_sequence_alignment												d2_sequence_alignment		TRUE	FALSE	Rearrangement	Rearrangement	d2_sequence_alignment	d2_sequence_alignment	FALSE	string	"Aligned portion of query sequence assigned to the second D gene, including any indel corrections or numbering spacers."														d2_sequence_alignment				d2_sequence_alignment	string	d2_sequence_alignment			
d2_sequence_alignment_aa	D2 Sequence Alignment AA	D2 Sequence Alignment AA		d2_sequence_alignment_aa	string	FALSE	FALSE				d2_sequence_alignment_aa												d2_sequence_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	d2_sequence_alignment_aa	d2_sequence_alignment_aa	FALSE	string	Amino acid translation of the d2_sequence_alignment field.														d2_sequence_alignment_aa				d2_sequence_alignment_aa	string	d2_sequence_alignment_aa			
j_sequence_alignment	J Sequence Alignment	J Sequence Alignment		j_sequence_alignment	string	FALSE	FALSE	2_IMGT-gapped-nt-sequences.txt	J-REGION	FALSE	j_sequence_alignment												j_sequence_alignment		TRUE	FALSE	Rearrangement	Rearrangement	j_sequence_alignment	j_sequence_alignment	FALSE	string	"Aligned portion of query sequence assigned to the J gene, including any indel corrections or numbering spacers."														j_sequence_alignment				j_sequence_alignment	string	j_sequence_alignment			
j_sequence_alignment_aa	J Sequence Alignment AA	J Sequence Alignment AA		j_sequence_alignment_aa	string	FALSE	FALSE	4_IMGT-gapped-AA-sequences.txt	J-REGION	FALSE	j_sequence_alignment_aa												j_sequence_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	j_sequence_alignment_aa	j_sequence_alignment_aa	FALSE	string	Amino acid translation of the j_sequence_alignment field.														j_sequence_alignment_aa				j_sequence_alignment_aa	string	j_sequence_alignment_aa			
c_sequence_alignment	C Sequence Alignment	C Sequence Alignment		c_sequence_alignment	string	FALSE	FALSE				c_sequence_alignment												c_sequence_alignment		TRUE	FALSE	Rearrangement	Rearrangement	c_sequence_alignment	c_sequence_alignment	FALSE	string	"Aligned portion of query sequence assigned to the constant region, including any indel corrections or numbering spacers."														c_sequence_alignment				c_sequence_alignment	string	c_sequence_alignment			
c_sequence_alignment_aa	C Sequence Alignment AA	C Sequence Alignment AA		c_sequence_alignment_aa	string	FALSE	FALSE				c_sequence_alignment_aa												c_sequence_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	c_sequence_alignment_aa	c_sequence_alignment_aa	FALSE	string	Amino acid translation of the c_sequence_alignment field.														c_sequence_alignment_aa				c_sequence_alignment_aa	string	c_sequence_alignment_aa			
v_germline_alignment	V Germline Alignment	V Germline Alignment		v_germline_alignment	string	FALSE	FALSE				v_germline_alignment												v_germline_alignment		TRUE	FALSE	Rearrangement	Rearrangement	v_germline_alignment	v_germline_alignment	FALSE	string	Aligned V gene germline sequence spanning the same region as the v_sequence_alignment field and including the same set of corrections and spacers (if any).														v_germline_alignment				v_germline_alignment	string	v_germline_alignment			
v_germline_alignment_aa	V Germline Alignment AA	V Germline Alignment AA		v_germline_alignment_aa	string	FALSE	FALSE				v_germline_alignment_aa												v_germline_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	v_germline_alignment_aa	v_germline_alignment_aa	FALSE	string	Amino acid translation of the v_germline_alignment field.														v_germline_alignment_aa				v_germline_alignment_aa	string	v_germline_alignment_aa			
d_germline_alignment	D Germline Alignment	D Germline Alignment		d_germline_alignment	string	FALSE	FALSE				d_germline_alignment												d_germline_alignment		TRUE	FALSE	Rearrangement	Rearrangement	d_germline_alignment	d_germline_alignment	FALSE	string	Aligned D gene germline sequence spanning the same region as the d_sequence_alignment field and including the same set of corrections and spacers (if any).														d_germline_alignment				d_germline_alignment	string	d_germline_alignment			
d_germline_alignment_aa	D Germline Alignment AA	D Germline Alignment AA		d_germline_alignment_aa	string	FALSE	FALSE				d_germline_alignment_aa												d_germline_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	d_germline_alignment_aa	d_germline_alignment_aa	FALSE	string	Amino acid translation of the d_germline_alignment field.														d_germline_alignment_aa				d_germline_alignment_aa	string	d_germline_alignment_aa			
d2_germline_alignment	D2 Germline Alignment	D2 Germline Alignment		d2_germline_alignment	string	FALSE	FALSE				d2_germline_alignment												d2_germline_alignment		TRUE	FALSE	Rearrangement	Rearrangement	d2_germline_alignment	d2_germline_alignment	FALSE	string	Aligned D gene germline sequence spanning the same region as the d2_sequence_alignment field and including the same set of corrections and spacers (if any).														d2_germline_alignment				d2_germline_alignment	string	d2_germline_alignment			
d2_germline_alignment_aa	D2 Germline Alignment AA	D2 Germline Alignment AA		d2_germline_alignment_aa	string	FALSE	FALSE				d2_germline_alignment_aa												d2_germline_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	d2_germline_alignment_aa	d2_germline_alignment_aa	FALSE	string	Amino acid translation of the d2_germline_alignment field.														d2_germline_alignment_aa				d2_germline_alignment_aa	string	d2_germline_alignment_aa			
j_germline_alignment	J Germline Alignment	J Germline Alignment		j_germline_alignment	string	FALSE	FALSE				j_germline_alignment												j_germline_alignment		TRUE	FALSE	Rearrangement	Rearrangement	j_germline_alignment	j_germline_alignment	FALSE	string	Aligned J gene germline sequence spanning the same region as the j_sequence_alignment field and including the same set of corrections and spacers (if any).														j_germline_alignment				j_germline_alignment	string	j_germline_alignment			
j_germline_alignment_aa	J Germline Alignment AA	J Germline Alignment AA		j_germline_alignment_aa	string	FALSE	FALSE				j_germline_alignment_aa												j_germline_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	j_germline_alignment_aa	j_germline_alignment_aa	FALSE	string	Amino acid translation of the j_germline_alignment field.														j_germline_alignment_aa				j_germline_alignment_aa	string	j_germline_alignment_aa			
c_germline_alignment	C Germline Alignment	C Germline Alignment		c_germline_alignment	string	FALSE	FALSE				c_germline_alignment												c_germline_alignment		TRUE	FALSE	Rearrangement	Rearrangement	c_germline_alignment	c_germline_alignment	FALSE	string	Aligned constant region germline sequence spanning the same region as the c_sequence_alignment field and including the same set of corrections and spacers (if any).														c_germline_alignment				c_germline_alignment	string	c_germline_alignment			
c_germline_alignment_aa	C Germline Alignment AA	C Germline Alignment AA		c_germline_alignment_aa	string	FALSE	FALSE				c_germline_alignment_aa												c_germline_alignment_aa		TRUE	FALSE	Rearrangement	Rearrangement	c_germline_alignment_aa	c_germline_alignment_aa	FALSE	string	Amino acid translation of the c_germline_aligment field.														c_germline_alignment_aa				c_germline_alignment_aa	string	c_germline_alignment_aa			
junction_length	Junction Length	Junction Length		junction_length	integer	FALSE	FALSE	6_Junction.txt	JUNCTION-nt nb	FALSE	junction_length												junction_length		TRUE	FALSE	Rearrangement	Rearrangement	junction_length	junction_length	FALSE	integer	Number of nucleotides in the junction sequence.														junction_length				junction_length	integer	junction_length			
ir_junction_aa_length	Junction AA Length	Junction AA Length		junction_aa_length	integer	FALSE	FALSE			TRUE	junction_aa_length												junction_aa_length		TRUE	FALSE	Rearrangement	Rearrangement	junction_aa_length	junction_aa_length	FALSE	integer	Number of amino acids in the junction sequence.			TRUE											junction_aa_length	TRUE	junction_aa_length	integer	junction_aa_length	integer	junction_aa_length			
np1_length	Np1 Length	Np1 Length		np1_length	integer	FALSE	FALSE	6_Junction.txt	"P3'V,N-REGION; N1-REGION,P5'D,P5'D1,P5'J"	TRUE	np1_length												np1_length		TRUE	FALSE	Rearrangement	Rearrangement	np1_length	np1_length	FALSE	integer	Number of nucleotides between the V gene and first D gene alignments or between the V gene and J gene alignments.														np1_length				np1_length	integer	np1_length			
np2_length	Np2 Length	Np2 Length		np2_length	integer	FALSE	FALSE	6_Junction.txt	"P3'D, P3'D1, N2-REGION,P5'D2,P5'J"	TRUE	np2_length												np2_length		TRUE	FALSE	Rearrangement	Rearrangement	np2_length	np2_length	FALSE	integer	Number of nucleotides between either the first D gene and J gene alignments or the first D gene and second D gene alignments.														np2_length				np2_length	integer	np2_length			
np3_length	Np3 Length	Np3 Length		np3_length	integer	FALSE	FALSE				np3_length												np3_length		TRUE	FALSE	Rearrangement	Rearrangement	np3_length	np3_length	FALSE	integer	Number of nucleotides between the second D gene and J gene alignments.														np3_length				np3_length	integer	np3_length			
n1_length	N1 Length	N1 Length		n1_length	integer	FALSE	FALSE	6_Junction.txt	N-REGION-nt nb or N1-REGION-nt nb	TRUE	n1_length												n1_length		TRUE	FALSE	Rearrangement	Rearrangement	n1_length	n1_length	FALSE	integer	Number of untemplated nucleotides 5' of the first or only D gene alignment.														n1_length				n1_length	integer	n1_length			
n2_length	N2 Length	N2 Length		n2_length	integer	FALSE	FALSE	6_Junction.txt	N2-REGION-nt nb	FALSE	n2_length												n2_length		TRUE	FALSE	Rearrangement	Rearrangement	n2_length	n2_length	FALSE	integer	Number of untemplated nucleotides 3' of the first or only D gene alignment.														n2_length				n2_length	integer	n2_length			
n3_length	N3 Length	N3 Length		n3_length	integer	FALSE	FALSE				n3_length												n3_length		TRUE	FALSE	Rearrangement	Rearrangement	n3_length	n3_length	FALSE	integer	Number of untemplated nucleotides 3' of the second D gene alignment.														n3_length				n3_length	integer	n3_length			
p3v_length	P3V Length	P3V Length		p3v_length	integer	FALSE	FALSE	6_Junction.txt	P3'V-nt nb	FALSE	p3v_length												p3v_length		TRUE	FALSE	Rearrangement	Rearrangement	p3v_length	p3v_length	FALSE	integer	Number of palindromic nucleotides 3' of the V gene alignment.														p3v_length				p3v_length	integer	p3v_length			
p5d_length	P5D Length	P5D Length		p5d_length	integer	FALSE	FALSE	6_Junction.txt	P5'D-nt nb or P3'D1-nt nb	TRUE	p5d_length												p5d_length		TRUE	FALSE	Rearrangement	Rearrangement	p5d_length	p5d_length	FALSE	integer	Number of palindromic nucleotides 5' of the first or only D gene alignment.														p5d_length				p5d_length	integer	p5d_length			
p3d_length	P3D Length	P3D Length		p3d_length	integer	FALSE	FALSE	6_Junction.txt	P3'D-nt nb or P3'D1-nt nb	TRUE	p3d_length												p3d_length		TRUE	FALSE	Rearrangement	Rearrangement	p3d_length	p3d_length	FALSE	integer	Number of palindromic nucleotides 3' of the first or only D gene alignment.														p3d_length				p3d_length	integer	p3d_length			
p5d2_length	P5D2 Length	P5D2 Length		p5d2_length	integer	FALSE	FALSE				p5d2_length												p5d2_length		TRUE	FALSE	Rearrangement	Rearrangement	p5d2_length	p5d2_length	FALSE	integer	Number of palindromic nucleotides 5' of the second D gene alignment.														p5d2_length				p5d2_length	integer	p5d2_length			
p3d2_length	P3D2 Length	P3D2 Length		p3d2_length	integer	FALSE	FALSE				p3d2_length												p3d2_length		TRUE	FALSE	Rearrangement	Rearrangement	p3d2_length	p3d2_length	FALSE	integer	Number of palindromic nucleotides 3' of the second D gene alignment.														p3d2_length				p3d2_length	integer	p3d2_length			
p5j_length	P5J Length	P5J Length		p5j_length	integer	FALSE	FALSE	6_Junction.txt	P5'J-nt nb	FALSE	p5j_length												p5j_length		TRUE	FALSE	Rearrangement	Rearrangement	p5j_length	p5j_length	FALSE	integer	Number of palindromic nucleotides 5' of the J gene alignment.														p5j_length				p5j_length	integer	p5j_length			
v_frameshift	V Frameshift	V Frameshift		v_frameshift	boolean	FALSE	FALSE				v_frameshift												v_frameshift		TRUE	FALSE	Rearrangement	Rearrangement	v_frameshift	v_frameshift	FALSE	boolean	True if the V gene in the query nucleotide sequence contains a translational frameshift relative to the frame of the V gene reference sequence.														v_frameshift				v_frameshift	boolean	v_frameshift			
j_frameshift	J Frameshift	J Frameshift		j_frameshift	boolean	FALSE	FALSE				j_frameshift												j_frameshift		TRUE	FALSE	Rearrangement	Rearrangement	j_frameshift	j_frameshift	FALSE	boolean	True if the J gene in the query nucleotide sequence contains a translational frameshift relative to the frame of the J gene reference sequence.														j_frameshift				j_frameshift	boolean	j_frameshift			
d_frame	D Frame	D Frame		d_frame	integer	FALSE	FALSE				d_frame												d_frame		TRUE	FALSE	Rearrangement	Rearrangement	d_frame	d_frame	FALSE	integer	"Numerical reading frame (1, 2, 3) of the first or only D gene in the query nucleotide sequence, where frame 1 is relative to the first codon of D gene reference sequence."														d_frame				d_frame	integer	d_frame			
d2_frame	D2 Frame	D2 Frame		d2_frame	integer	FALSE	FALSE				d2_frame												d2_frame		TRUE	FALSE	Rearrangement	Rearrangement	d2_frame	d2_frame	FALSE	integer	"Numerical reading frame (1, 2, 3) of the second D gene in the query nucleotide sequence, where frame 1 is relative to the first codon of D gene reference sequence."														d2_frame				d2_frame	integer	d2_frame			
consensus_count	Consensus Count	Consensus Count		consensus_count	integer	FALSE	FALSE				consensus_count				reads								consensus_count		TRUE	FALSE	Rearrangement	Rearrangement	consensus_count	consensus_count	FALSE	integer	"Number of reads contributing to the UMI consensus or contig assembly for this sequence. For example, the sum of the number of reads for all UMIs that contribute to the query sequence."														consensus_count				consensus_count	integer	consensus_count			
duplicate_count	Read Count	Read Count		duplicate_count	integer	FALSE	FALSE				duplicate_count			templates									duplicate_count	Read count	TRUE	FALSE	Rearrangement	Rearrangement	duplicate_count	duplicate_count	FALSE	integer	"Copy number or number of duplicate observations for the query sequence. For example, the number of identical reads observed for this sequence."	Read count	TRUE			123	TRUE	6	data (processed sequence)						duplicate_count				duplicate_count	integer	duplicate_count			
umi_count	Umi Count	Umi Count		umi_count	integer	FALSE	FALSE				umi_count				umis								umi_count		TRUE	FALSE	Rearrangement	Rearrangement	umi_count	umi_count	FALSE	integer	"Number of distinct UMIs represented by this sequence. For example, the total number of UMIs that contribute to the contig assembly for the query sequence."														umi_count				umi_count	integer	umi_count			
pair_id_deprecated							FALSE																																																	
cell_id	Cell Index	Cell Index		cell_id	string	FALSE	FALSE				cell_id				barcode								cell_id	Cell index	TRUE	FALSE	Rearrangement	Rearrangement	cell_id	cell_id	FALSE	string	Identifier defining the cell of origin for the query sequence.	Cell index	TRUE	TRUE	TRUE	W06_046_091	TRUE	6	data (processed sequence)						cell_id	TRUE	cell_id	string	cell_id	string	cell_id			
clone_id	Clone ID	Clone ID		clone_id	string	FALSE	FALSE				clone_id												clone_id		TRUE	FALSE	Rearrangement	Rearrangement	clone_id	clone_id	FALSE	string	Clonal cluster assignment for the query sequence.		TRUE	TRUE	TRUE										clone_id	TRUE	clone_id	string	clone_id	string	clone_id			
rearrangement_id_deprecated	Rearrangement ID	Rearrangement ID		rearrangement_id	string	FALSE	FALSE																rearrangement_id		TRUE	FALSE	Rearrangement	Rearrangement	rearrangement_id	rearrangement_id	FALSE	string	"Identifier for the Rearrangement object. May be identical to sequence_id, but will usually be a universally unique record locator for database applications."										TRUE	Field has been merged with sequence_id to avoid confusion.	['sequence_id']		rearrangement_id	TRUE	rearrangement_id	string	rearrangement_id	string	rearrangement_id			
repertoire_id_rearrangement	Repertoire ID	Repertoire ID		repertoire_id	string	FALSE	FALSE																repertoire_id		TRUE	FALSE	Rearrangement	Rearrangement	repertoire_id	repertoire_id	FALSE	string	Identifier to the associated repertoire in study metadata.		TRUE	TRUE	TRUE										ir_project_sample_id	TRUE	repertoire_id	string	repertoire_id	string	repertoire_id			
sample_processing_id_rearrangement	Sample Processing ID	Sample Processing ID		sample_processing_id	string	FALSE	FALSE																sample_processing_id		TRUE	FALSE	Rearrangement	Rearrangement	sample_processing_id	sample_processing_id	FALSE	string	Identifier to the sample processing object in the repertoire metadata for this rearrangement. If the repertoire has a single sample then this field may be empty or missing. If the repertoire has multiple samples then this field may be empty or missing if the sample cannot be differentiated or the relationship is not maintained by the data processing.		TRUE	TRUE	TRUE										sample_processing_id	TRUE	sample_processing_id	string	sample_processing_id	string	sample_processing_id			
data_processing_id_rearrangement	Data Processing ID	Data Processing ID		data_processing_id	string	FALSE	FALSE																data_processing_id		TRUE	FALSE	Rearrangement	Rearrangement	data_processing_id	data_processing_id	FALSE	string	Identifier to the data processing object in the repertoire metadata for this rearrangement. If this field is empty than the primary data processing object is assumed.		TRUE	TRUE	TRUE										data_processing_id	TRUE	data_processing_id	string	data_processing_id	string	data_processing_id			
germline_database_deprecated	Germline Database	Germline Database		germline_database	string	FALSE	FALSE																germline_database		TRUE	FALSE	Rearrangement	Rearrangement	germline_database	germline_database	FALSE	string	Source of germline V(D)J genes with version number or date accessed.					"ENSEMBL, Homo sapiens build 90, 2017-10-01"					TRUE	Field was moved up to the DataProcessing level to avoid data duplication.	['DataProcessing:germline_database']		germline_database				germline_database	string	germline_database			
rearrangement_set_id_deprecated	Rearrangement Set ID	Rearrangement Set ID		rearrangement_set_id	string	FALSE	FALSE																rearrangement_set_id		TRUE	FALSE	Rearrangement	Rearrangement	rearrangement_set_id	rearrangement_set_id	FALSE	string	Identifier for grouping Rearrangement objects.										TRUE	Field has been replaced by other specialized identifiers.	"['repertoire_id', 'sample_processing_id', 'data_processing_id']"		rearrangement_set_id				rearrangement_set_id	string	rearrangement_set_id			
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_annotation_set_metadata_id_rearrangement				ir_annotation_set_metadata_id_rearrangement	string	FALSE	FALSE																				IR_Rearrangement	IR_RearrangementDB			FALSE	string															ir_annotation_set_metadata_id_rearrangement									
ir_sequence_id_rearrangement	Sequence ID from Annotation Tool	Tool Sequence ID		adc_annotation_sequence_id	string	FALSE	FALSE																adc_annotation_sequence_id				IR_Rearrangement	IR_RearrangementDB	adc_annotation_sequence_id	adc_annotation_sequence_id	FALSE	string															adc_annotation_sequence_id				adc_annotation_sequence_id	string	adc_annotation_sequence_id			
ir_substring	Junction Substring	Junction Substring		ir_substring	string	TRUE	FALSE																				IR_Rearrangement	IR_RearrangementDB			FALSE	string															substring									
ir_vgene_family	V-Gene Family	V-Gene Family		ir_vgene_family	string	TRUE	FALSE																				IR_Rearrangement	IR_RearrangementDB	v_subgroup	v_subgroup	FALSE	string															vgene_family									
ir_vgene_gene	V-Gene Gene	V-Gene Gene		ir_vgene_gene	string	TRUE	FALSE																				IR_Rearrangement	IR_RearrangementDB	v_gene	v_gene	FALSE	string															vgene_gene									
ir_jgene_family	J-Gene Family	J-Gene Family		ir_jgene_family	string	TRUE	FALSE																				IR_Rearrangement	IR_RearrangementDB	j_subgroup	j_subgroup	FALSE	string															jgene_family									
ir_jgene_gene	J-Gene Gene	J-Gene Gene		ir_jgene_gene	string	TRUE	FALSE																				IR_Rearrangement	IR_RearrangementDB	j_gene	j_gene	FALSE	string															jgene_gene									
ir_dgene_family	D-Gene Family	D-Gene Family		ir_dgene_family	string	TRUE	FALSE																				IR_Rearrangement	IR_RearrangementDB	d_subgroup	d_subgroup	FALSE	string															dgene_family									
ir_dgene_gene	D-Gene Gene	D-Gene Gene		ir_dgene_gene	string	TRUE	FALSE																				IR_Rearrangement	IR_RearrangementDB	d_gene	d_gene	FALSE	string															dgene_gene									
ir_created_at_rearrangement	Creation Date	Creation Date		ir_created_at_rearrangement	string	FALSE	FALSE																				IR_Rearrangement	IR_RearrangementDB			FALSE	string															ir_created_at_rearrangement									
ir_updated_at_rearrangement	Update Date	Update Date		ir_updated_at_rearrangement	string	FALSE	FALSE																				IR_Rearrangement	IR_RearrangementDB			FALSE	string															ir_updated_at_rearrangement									
ir_clone_id_rearrangement	Clone ID from Annotation Tool	Tool Clone ID		adc_annotation_clone_id	string	FALSE	FALSE																adc_annotation_clone_id				IR_Rearrangement	IR_RearrangementDB	adc_annotation_clone_id	adc_annotation_clone_id	FALSE	string															adc_annotation_clone_id				adc_annotation_clone_id	string	adc_annotation_clone_id			
ir_cell_id_rearrangement	Cell ID from Annotation Tool	Tool Cell ID		adc_annotation_cell_id	string	FALSE	FALSE																adc_annotation_cell_id				IR_Rearrangement	IR_RearrangementDB	adc_annotation_cell_id	adc_annotation_cell_id	FALSE	string															adc_annotation_cell_id				adc_annotation_cell_id	string	adc_annotation_cell_id			
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
clone_id_clone	Clone ID	Clone ID		clone_id	string	FALSE	FALSE					cloneId	cloneId		clone_id	clone_id							clone_id		TRUE	TRUE	Clone	Clone	clone_id	clone_id	FALSE	string	Identifier for the clone.				TRUE										clone_id				clone_id	string	clone_id			
repertoire_id_clone	Repertoire ID	Repertoire ID		repertoire_id	string	FALSE	FALSE																repertoire_id		TRUE	FALSE	Clone	Clone	repertoire_id	repertoire_id	FALSE	string	Identifier to the associated repertoire in study metadata.		TRUE	TRUE											repertoire_id				repertoire_id	string	repertoire_id			
data_processing_id_clone	Data Processing ID	Data Processing ID		data_processing_id	string	FALSE	FALSE																data_processing_id		TRUE	FALSE	Clone	Clone	data_processing_id	data_processing_id	FALSE	string	Identifier of the data processing object in the repertoire metadata for this clone.		TRUE	TRUE											data_processing_id				data_processing_id	string	data_processing_id			
sequences_clone	Sequences	Sequences		sequences	string	TRUE	FALSE																sequences		TRUE	FALSE	Clone	Clone	sequences	sequences	TRUE	string	List sequence_id strings that act as keys to the Rearrangement records for members of the clone.														sequences				sequences	string	sequences			
v_call_clone	V Call	V Call		v_call	string	FALSE	FALSE					bestVGene	bestVGene		v_gene	v_gene							v_call		TRUE	FALSE	Clone	Clone	v_call	v_call	FALSE	string	"V gene with allele of the inferred ancestral of the clone. For example, IGHV4-59*01."					IGHV4-59*01									v_call				v_call	string	v_call			
d_call_clone	D Call	D Call		d_call	string	FALSE	FALSE					bestDGene	bestDGene		d_gene	d_gene							d_call		TRUE	FALSE	Clone	Clone	d_call	d_call	FALSE	string	"D gene with allele of the inferred ancestor of the clone. For example, IGHD3-10*01."					IGHD3-10*01									d_call				d_call	string	d_call			
j_call_clone	J Call	J Call		j_call	string	FALSE	FALSE					bestJGene	bestJGene		j_gene	j_gene							j_call		TRUE	FALSE	Clone	Clone	j_call	j_call	FALSE	string	"J gene with allele of the inferred ancestor of the clone. For example, IGHJ4*02."					IGHJ4*02									j_call				j_call	string	j_call			
junction_clone	Junction	Junction		junction	string	FALSE	FALSE					nSeqCDR3	nSeqCDR3		cdr3_nt	cdr3_nt							junction		TRUE	FALSE	Clone	Clone	junction	junction	FALSE	string	"Nucleotide sequence for the junction region of the inferred ancestor of the clone, where the junction is defined as the CDR3 plus the two flanking conserved codons."														junction				junction	string	junction			
junction_aa_clone	Junction AA	Junction AA		junction_aa	string	FALSE	FALSE					aaSeqCDR3	aaSeqCDR3		cdr3_aa	cdr3_aa							junction_aa		TRUE	FALSE	Clone	Clone	junction_aa	junction_aa	FALSE	string	Amino acid translation of the junction.														junction_aa				junction_aa	string	junction_aa			
junction_length_clone	Junction Length	Junction Length		junction_length	integer	FALSE	FALSE					lengthOfCDR3	lengthOfCDR3										junction_length		TRUE	FALSE	Clone	Clone	junction_length	junction_length	FALSE	integer	Number of nucleotides in the junction.														junction_length				junction_length	integer	junction_length			
junction_aa_length_clone	Junction AA Length	Junction AA Length		junction_aa_length	integer	FALSE	FALSE																junction_aa_length		TRUE	FALSE	Clone	Clone	junction_aa_length	junction_aa_length	FALSE	integer	Number of amino acids in junction_aa.														junction_aa_length				junction_aa_length	integer	junction_aa_length			
germline_alignment_clone	Germline Alignment	Germline Alignment		germline_alignment	string	FALSE	FALSE																germline_alignment		TRUE	TRUE	Clone	Clone	germline_alignment	germline_alignment	FALSE	string	"Assembled, aligned, full-length inferred ancestor of the clone spanning the same region as the sequence_alignment field of nodes (typically the V(D)J region) and including the same set of corrections and spacers (if any)."														germline_alignment				germline_alignment	string	germline_alignment			
germline_alignment_aa_clone	Germline Alignment AA	Germline Alignment AA		germline_alignment_aa	string	FALSE	FALSE																germline_alignment_aa		TRUE	FALSE	Clone	Clone	germline_alignment_aa	germline_alignment_aa	FALSE	string	Amino acid translation of germline_alignment.														germline_alignment_aa				germline_alignment_aa	string	germline_alignment_aa			
v_alignment_start_clone	V Alignment Start	V Alignment Start		v_alignment_start	integer	FALSE	FALSE																v_alignment_start		TRUE	FALSE	Clone	Clone	v_alignment_start	v_alignment_start	FALSE	integer	Start position in the V gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														v_alignment_start				v_alignment_start	integer	v_alignment_start			
v_alignment_end_clone	V Alignment End	V Alignment End		v_alignment_end	integer	FALSE	FALSE																v_alignment_end		TRUE	FALSE	Clone	Clone	v_alignment_end	v_alignment_end	FALSE	integer	End position in the V gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														v_alignment_end				v_alignment_end	integer	v_alignment_end			
d_alignment_start_clone	D Alignment Start	D Alignment Start		d_alignment_start	integer	FALSE	FALSE																d_alignment_start		TRUE	FALSE	Clone	Clone	d_alignment_start	d_alignment_start	FALSE	integer	Start position of the D gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														d_alignment_start				d_alignment_start	integer	d_alignment_start			
d_alignment_end_clone	D Alignment End	D Alignment End		d_alignment_end	integer	FALSE	FALSE																d_alignment_end		TRUE	FALSE	Clone	Clone	d_alignment_end	d_alignment_end	FALSE	integer	End position of the D gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														d_alignment_end				d_alignment_end	integer	d_alignment_end			
j_alignment_start_clone	J Alignment Start	J Alignment Start		j_alignment_start	integer	FALSE	FALSE																j_alignment_start		TRUE	FALSE	Clone	Clone	j_alignment_start	j_alignment_start	FALSE	integer	Start position of the J gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														j_alignment_start				j_alignment_start	integer	j_alignment_start			
j_alignment_end_clone	J Alignment End	J Alignment End		j_alignment_end	integer	FALSE	FALSE																j_alignment_end		TRUE	FALSE	Clone	Clone	j_alignment_end	j_alignment_end	FALSE	integer	End position of the J gene alignment in both the sequence_alignment and germline_alignment fields (1-based closed interval).														j_alignment_end				j_alignment_end	integer	j_alignment_end			
junction_start_clone	Junction Start	Junction Start		junction_start	integer	FALSE	FALSE																junction_start		TRUE	FALSE	Clone	Clone	junction_start	junction_start	FALSE	integer	Junction region start position in the alignment (1-based closed interval).														junction_start				junction_start	integer	junction_start			
junction_end_clone	Junction End	Junction End		junction_end	integer	FALSE	FALSE																junction_end		TRUE	FALSE	Clone	Clone	junction_end	junction_end	FALSE	integer	Junction region end position in the alignment (1-based closed interval).														junction_end				junction_end	integer	junction_end			
sequence_count_clone	Umi Count	Umi Count		umi_count	integer	FALSE	FALSE					cloneCount	cloneCount		copies	copies							umi_count		TRUE	FALSE	Clone	Clone	umi_count	umi_count	FALSE	integer	Number of distinct UMIs observed across all sequences (Rearrangement records) in this clone.														umi_count				umi_count	integer	umi_count			
clone_abundance_clone	Clone Count	Clone Count		clone_count	integer	FALSE	FALSE																clone_count		TRUE	FALSE	Clone	Clone	clone_count	clone_count	FALSE	integer	"Absolute count of the size (number of members) of this clone in the repertoire. This could simply be the number of sequences (Rearrangement records) observed in this clone, the number of distinct cell barcodes (unique cell_id values), or a more sophisticated calculation appropriate to the experimental protocol. Absolute count is provided versus a frequency so that downstream analysis tools can perform their own normalization."														clone_count				clone_count	integer	clone_count			
seed_id_clone	Seed ID	Seed ID		seed_id	string	FALSE	FALSE																seed_id		TRUE	FALSE	Clone	Clone	seed_id	seed_id	FALSE	string	sequence_id of the seed sequence. Empty string (or null) if there is no seed sequence.														seed_id				seed_id	string	seed_id			
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_clone_id_clone	Clone ID from Annotation Tool	Tool Clone ID		adc_annotation_clone_id	string	FALSE	FALSE																adc_annotation_clone_id				IR_Clone	IR_CloneDB	adc_annotation_clone_id	adc_annotation_clone_id	FALSE	string															adc_annotation_clone_id				adc_annotation_clone_id	string	adc_annotation_clone_id			
ir_substring_clone				ir_substring_clone	string	TRUE	FALSE																				IR_Clone	IR_CloneDB			FALSE	string															substring									
ir_annotation_set_metadata_id_clone				ir_annotation_set_metadata_id_clone	string	FALSE	FALSE																				IR_Clone	IR_CloneDB			FALSE	string															ir_annotation_set_metadata_id_clone									
ir_vgene_family_clone	V-Gene Family	V-Gene Family		ir_vgene_family_clone	string	TRUE	FALSE																				IR_Clone	IR_CloneDB	v_subgroup	v_subgroup	FALSE	string															vgene_family									
ir_vgene_gene_clone	V-Gene Gene	V-Gene Gene		ir_vgene_gene_clone	string	TRUE	FALSE																				IR_Clone	IR_CloneDB	v_gene	v_gene	FALSE	string															vgene_gene									
ir_jgene_family_clone	J-Gene Family	J-Gene Family		ir_jgene_family_clone	string	TRUE	FALSE																				IR_Clone	IR_CloneDB	j_subgroup	j_subgroup	FALSE	string															jgene_family									
ir_jgene_gene_clone	J-Gene Gene	J-Gene Gene		ir_jgene_gene_clone	string	TRUE	FALSE																				IR_Clone	IR_CloneDB	j_gene	j_gene	FALSE	string															jgene_gene									
ir_dgene_family_clone	D-Gene Family	D-Gene Family		ir_dgene_family_clone	string	TRUE	FALSE																				IR_Clone	IR_CloneDB	d_subgroup	d_subgroup	FALSE	string															dgene_family									
ir_dgene_gene_clone	D-Gene Gene	D-Gene Gene		ir_dgene_gene_clone	string	TRUE	FALSE																				IR_Clone	IR_CloneDB	d_gene	d_gene	FALSE	string															dgene_gene									
ir_created_at_clone	Creation Date	Creation Date		ir_created_at_clone	string	FALSE	FALSE																				IR_Clone	IR_CloneDB			FALSE	string															ir_created_at_clone									
ir_updated_at_clone	Update Date	Update Date		ir_updated_at_clone	string	FALSE	FALSE																				IR_Clone	IR_CloneDB			FALSE	string															ir_updated_at_clone									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
ir_annotation_set_metadata_id_stats				ir_annotation_set_metadata_id			FALSE																				IRPlus_stats	IRPlus_stats_all				string															ir_project_sample_id									
rearrangement_count_stats				rearrangement_count			FALSE																				IRPlus_stats	IRPlus_stats_rearrangement_count				string															rearrangement_count							rearrangement_count	rearrangement_count	
rearrangement_count_productive_stats				rearrangement_count_productive			FALSE																				IRPlus_stats	IRPlus_stats_rearrangement_count				string															rearrangement_count_productive							rearrangement_count_productive	rearrangement_count_productive	
duplicate_count_stats				duplicate_count			FALSE																				IRPlus_stats	IRPlus_stats_rearrangement_count				string															duplicate_count							duplicate_count	duplicate_count	
duplicate_count_productive_stats				duplicate_count_productive			FALSE																				IRPlus_stats	IRPlus_stats_rearrangement_count				string															duplicate_count_productive							duplicate_count_productive	duplicate_count_productive	
junction_length_stats				junction_length			FALSE																				IRPlus_stats	IRPlus_stats_junction_length				string															junction_length							junction_length	junction_length	
junction_aa_length_stats				junction_aa_length			FALSE																				IRPlus_stats	IRPlus_stats_junction_length				string															junction_aa_length							junction_aa_length	junction_aa_length	
junction_length_productive_stats				junction_length_productive			FALSE																				IRPlus_stats	IRPlus_stats_junction_length				string															junction_length_productive							junction_length_productive	junction_length_productive	
junction_aa_length_productive_stats				junction_aa_length_productive			FALSE																				IRPlus_stats	IRPlus_stats_junction_length				string															junction_aa_length_productive							junction_aa_length_productive	junction_aa_length_productive	
v_call_unique_stats				v_call_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_call_unique							v_call_unique	v_call_unique	
v_call_exists_stats				v_call_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_call_exists							v_call_exists	v_call_exists	
v_family_unique_stats				v_family_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_subgroup_unique							v_subgroup_unique	v_subgroup_unique	
v_family_exists_stats				v_family_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_subgroup_exists							v_subgroup_exists	v_subgroup_exists	
v_gene_unique_stats				v_gene_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_gene_unique							v_gene_unique	v_gene_unique	
v_gene_exists_stats				v_gene_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_gene_exists							v_gene_exists	v_gene_exists	
d_call_unique_stats				d_call_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_call_unique							d_call_unique	d_call_unique	
d_call_exists_stats				d_call_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_call_exists							d_call_exists	d_call_exists	
d_family_unique_stats				d_family_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_subgroup_unique							d_subgroup_unique	d_subgroup_unique	
d_family_exists_stats				d_family_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_subgroup_exists							d_subgroup_exists	d_subgroup_exists	
d_gene_unique_stats				d_gene_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_gene_unique							d_gene_unique	d_gene_unique	
d_gene_exists_stats				d_gene_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_gene_exists							d_gene_exists	d_gene_exists	
j_call_unique_stats				j_call_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_call_unique							j_call_unique	j_call_unique	
j_call_exists_stats				j_call_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_call_exists							j_call_exists	j_call_exists	
j_family_unique_stats				j_family_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_subgroup_unique							j_subgroup_unique	j_subgroup_unique	
j_family_exists_stats				j_family_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_subgroup_exists							j_subgroup_exists	j_subgroup_exists	
j_gene_unique_stats				j_gene_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_gene_unique							j_gene_unique	j_gene_unique	
j_gene_exists_stats				j_gene_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_gene_exists							j_gene_exists	j_gene_exists	
c_call_unique_stats				c_call_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_call_unique							c_call_unique	c_call_unique	
c_call_exists_stats				c_call_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_call_exists							c_call_exists	c_call_exists	
c_family_unique_stats				c_family_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_subgroup_unique							c_subgroup_unique	c_subgroup_unique	
c_family_exists_stats				c_family_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_subgroup_exists							c_subgroup_exists	c_subgroup_exists	
c_gene_unique_stats				c_gene_unique			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_gene_unique							c_gene_unique	c_gene_unique	
c_gene_exists_stats				c_gene_exists			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_gene_exists							c_gene_exists	c_gene_exists	
v_call_unique_productive_stats				v_call_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_call_unique_productive							v_call_unique_productive	v_call_unique_productive	
v_call_exists_productive_stats				v_call_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_call_exists_productive							v_call_exists_productive	v_call_exists_productive	
v_family_unique_productive_stats				v_family_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_subgroup_unique_productive							v_subgroup_unique_productive	v_subgroup_unique_productive	
v_family_exists_productive_stats				v_family_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_subgroup_exists_productive							v_subgroup_exists_productive	v_subgroup_exists_productive	
v_gene_unique_productive_stats				v_gene_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_gene_unique_productive							v_gene_unique_productive	v_gene_unique_productive	
v_gene_exists_productive_stats				v_gene_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															v_gene_exists_productive							v_gene_exists_productive	v_gene_exists_productive	
d_call_unique_productive_stats				d_call_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_call_unique_productive							d_call_unique_productive	d_call_unique_productive	
d_call_exists_productive_stats				d_call_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_call_exists_productive							d_call_exists_productive	d_call_exists_productive	
d_family_unique_productive_stats				d_family_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_subgroup_unique_productive							d_subgroup_unique_productive	d_subgroup_unique_productive	
d_family_exists_productive_stats				d_family_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_subgroup_exists_productive							d_subgroup_exists_productive	d_subgroup_exists_productive	
d_gene_unique_productive_stats				d_gene_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_gene_unique_productive							d_gene_unique_productive	d_gene_unique_productive	
d_gene_exists_productive_stats				d_gene_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															d_gene_exists_productive							d_gene_exists_productive	d_gene_exists_productive	
j_call_unique_productive_stats				j_call_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_call_unique_productive							j_call_unique_productive	j_call_unique_productive	
j_call_exists_productive_stats				j_call_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_call_exists_productive							j_call_exists_productive	j_call_exists_productive	
j_family_unique_productive_stats				j_family_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_subgroup_unique_productive							j_subgroup_unique_productive	j_subgroup_unique_productive	
j_family_exists_productive_stats				j_family_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_subgroup_exists_productive							j_subgroup_exists_productive	j_subgroup_exists_productive	
j_gene_unique_productive_stats				j_gene_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_gene_unique_productive							j_gene_unique_productive	j_gene_unique_productive	
j_gene_exists_productive_stats				j_gene_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															j_gene_exists_productive							j_gene_exists_productive	j_gene_exists_productive	
c_call_unique_productive_stats				c_call_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_call_unique_productive							c_call_unique_productive	c_call_unique_productive	
c_call_exists_productive_stats				c_call_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_call_exists_productive							c_call_exists_productive	c_call_exists_productive	
c_family_unique_productive_stats				c_family_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_subgroup_unique_productive							c_subgroup_unique_productive	c_subgroup_unique_productive	
c_family_exists_productive_stats				c_family_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_subgroup_exists_productive							c_subgroup_exists_productive	c_subgroup_exists_productive	
c_gene_unique_productive_stats				c_gene_unique_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_gene_unique_productive							c_gene_unique_productive	c_gene_unique_productive	
c_gene_exists_productive_stats				c_gene_exists_productive			FALSE																				IRPlus_stats	IRPlus_stats_gene_usage				string															c_gene_exists_productive							c_gene_exists_productive	c_gene_exists_productive	
total_stats				total			FALSE																				IRPlus_stats	IRPlus_stats_all																			total								total	
name_stats							FALSE																				IRPlus_stats	IRPlus_stats_all																			statistics							statistics	statistics	
statistic_name_stats				name			FALSE																				IRPlus_stats	IRPlus_stats_all																			statistic_name								statistic_name	
data_stats							FALSE																				IRPlus_stats	IRPlus_stats_all																			data								data	
key_stats							FALSE																				IRPlus_stats	IRPlus_stats_all																			key								key	
count_stats							FALSE																				IRPlus_stats	IRPlus_stats_all																			value								count	
repertoires_stats							FALSE																				IRPlus_stats	IRPlus_stats_all																			repertoires							repertoires	repertoires	
repertoire_stats							FALSE																				IRPlus_stats	IRPlus_stats_all																			repertoire							repertoire	repertoire	
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
cell_id_cell	Cell Index	Cell Index		cell_id	string	FALSE	FALSE																cell_id	Cell index	TRUE	TRUE	Cell	Cell	cell_id	cell_id	FALSE	string	Identifier defining the cell of origin for the query sequence.	Cell index	FALSE	TRUE	TRUE	W06_046_091	TRUE								cell_id				cell_id	string	cell_id			
rearrangements_cell	Cell-Associated Rearrangements	Cell-Associated Rearrangements		rearrangements	string	TRUE	FALSE																rearrangements	Cell-associated rearrangements	TRUE	TRUE	Cell	Cell	rearrangements	rearrangements	TRUE	string	Array of sequence identifiers defined for the Rearrangement object	Cell-associated rearrangements	TRUE	TRUE		"['id1', 'id2']"	TRUE								rearrangements				rearrangements	string	rearrangements			
receptors_cell	Cell-Associated Receptors	Cell-Associated Receptors		receptors	string	TRUE	FALSE																receptors	Cell-associated receptors	TRUE	FALSE	Cell	Cell	receptors	receptors	TRUE	string	Array of receptor identifiers defined for the Receptor object	Cell-associated receptors	TRUE	TRUE		"['id1', 'id2']"	TRUE								receptors				receptors	string	receptors			
repertoire_id_cell	Parental Repertoire Of Cell	Parental Repertoire Of Cell		repertoire_id	string	FALSE	FALSE																repertoire_id	Parental repertoire of cell	TRUE	TRUE	Cell	Cell	repertoire_id	repertoire_id	FALSE	string	Identifier to the associated repertoire in study metadata.	Parental repertoire of cell	TRUE	TRUE			TRUE								repertoire_id				repertoire_id	string	repertoire_id			
data_processing_id_cell	Data Processing For Cell	Data Processing For Cell		data_processing_id	string	FALSE	FALSE																data_processing_id	Data processing for cell	TRUE	FALSE	Cell	Cell	data_processing_id	data_processing_id	FALSE	string	Identifier of the data processing object in the repertoire metadata for this clone.	Data processing for cell	TRUE	TRUE			TRUE								data_processing_id				data_processing_id	string	data_processing_id			
expression_study_method_cell	Expression Study Method	Expression Study Method		expression_study_method	string	FALSE	FALSE																expression_study_method		TRUE	FALSE	Cell	Cell	expression_study_method	expression_study_method	FALSE	string	Keyword describing the methodology used to assess expression. This values for this field MUST  come from a controlled vocabulary.		TRUE	TRUE			TRUE							"flow_cytometry,single-cell_transcriptome,null"	expression_study_method				expression_study_method	string	expression_study_method			
expression_raw_doi_cell	Expression Raw Doi	Expression Raw Doi		expression_raw_doi	string	FALSE	FALSE																expression_raw_doi		TRUE	FALSE	Cell	Cell	expression_raw_doi	expression_raw_doi	FALSE	string	DOI of raw data set containing the current event		TRUE	TRUE			TRUE								expression_raw_doi				expression_raw_doi	string	expression_raw_doi			
expression_index_cell	Expression Index	Expression Index		expression_index	string	FALSE	FALSE																expression_index		TRUE	FALSE	Cell	Cell	expression_index	expression_index	FALSE	string	Index addressing the current event within the raw data set.		TRUE				TRUE								expression_index				expression_index	string	expression_index			
virtual_pairing_cell	Virtual Pairing	Virtual Pairing		virtual_pairing	boolean	FALSE	FALSE																virtual_pairing	Virtual pairing	TRUE	TRUE	Cell	Cell	virtual_pairing	virtual_pairing	FALSE	boolean	boolean to indicate if pairing was inferred.	Virtual pairing	TRUE	TRUE			TRUE								virtual_pairing				virtual_pairing	boolean	virtual_pairing			
ir_cell_id_cell	Cell ID from Annotation Tool	Tool Cell ID		adc_annotation_cell_id	string	FALSE	FALSE																adc_annotation_cell_id				IR_Cell	IR_CellDB	adc_annotation_cell_id	adc_annotation_cell_id	FALSE	string															adc_annotation_cell_id				adc_annotation_cell_id	string	adc_annotation_cell_id			
ir_annotation_set_metadata_id_cell				ir_annotation_set_metadata_id_cell	string	FALSE	FALSE																				IR_Cell	IR_CellDB			FALSE	string															ir_annotation_set_metadata_id_cell									
ir_created_at_cell	Creation Date	Creation Date		ir_created_at_cell	string	FALSE	FALSE																				IR_Cell	IR_CellDB			FALSE	string															ir_created_at_cell									
ir_updated_at_cell	Update Date	Update Date		ir_updated_at_cell	string	FALSE	FALSE																				IR_Cell	IR_CellDB			FALSE	string															ir_updated_at_cell									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
expression_id_expression	Expression Measurement IDentifier	Expression Measurement IDentifier		expression_id	string	FALSE	FALSE																expression_id	Expression measurement identifier	TRUE	TRUE	CellExpression	CellExpression	expression_id	expression_id	FALSE	string	Identifier of this expression property measurement.	Expression property measurement identifier	FALSE	TRUE	TRUE		TRUE								expression_id				expression_id	string	expression_id			
cell_id_expression	Cell IDentifier	Cell IDentifier		cell_id	string	FALSE	FALSE																cell_id	Cell identifier	TRUE	TRUE	CellExpression	CellExpression	cell_id	cell_id	FALSE	string	Identifier of the cell to which this expression data is related.	Cell identifier	FALSE	TRUE		W06_046_091	TRUE								cell_id				cell_id	string	cell_id			
repertoire_id_expression	Parental Repertoire Of Cell	Parental Repertoire Of Cell		repertoire_id	string	FALSE	FALSE																repertoire_id	Parental repertoire of cell	TRUE	TRUE	CellExpression	CellExpression	repertoire_id	repertoire_id	FALSE	string	Identifier for the associated repertoire in study metadata.	Parental repertoire of cell	TRUE	TRUE			TRUE								repertoire_id				repertoire_id	string	repertoire_id			
data_processing_id_expression	Data Processing For Cell	Data Processing For Cell		data_processing_id	string	FALSE	FALSE																data_processing_id	Data processing for cell	TRUE	TRUE	CellExpression	CellExpression	data_processing_id	data_processing_id	FALSE	string	Identifier of the data processing object in the repertoire metadata for this clone.	Data processing for cell	TRUE	TRUE			TRUE								data_processing_id				data_processing_id	string	data_processing_id			
property_expression	Property Information	Property Information		property	string	FALSE	FALSE																property	Property information	TRUE	TRUE	CellExpression	CellExpression	property.label	property.label	FALSE	string	"Name of the property observed, typically a gene or antibody idenifier (and its label) from a  canonical resource such as Ensembl (e.g. ENSG00000275747, IGHV3-79) or  Antibody Registry (ABREG:1236456, Purified anti-mouse/rat/human CD27 antibody)."	Property information		TRUE		"ENSG:ENSG00000275747, IGHV3-79"	TRUE			ontology					property				property	string	property			
property_id_expression	Property Information (Ontology ID)	Property Information (Ontology ID)		property_id	string	FALSE	FALSE																property_id	Property information (Ontology ID)	TRUE	TRUE	CellExpression	CellExpression	property.id	property.id	FALSE	string	"Name of the property observed, typically a gene or antibody idenifier (and its label) from a  canonical resource such as Ensembl (e.g. ENSG00000275747, IGHV3-79) or  Antibody Registry (ABREG:1236456, Purified anti-mouse/rat/human CD27 antibody). (Ontology ID)"	Property information (Ontology ID)		TRUE		"ENSG:ENSG00000275747, IGHV3-79"	TRUE			ontology					property_id				property_id	string	property_id			
value_expression	Property Value	Property Value		value	number	FALSE	FALSE																value	Property value	TRUE	TRUE	CellExpression	CellExpression	value	value	FALSE	number	Level at which the property was observed in the experiment (non-normalized).	Property value	TRUE	TRUE		3	TRUE								value				value	number	value			
ir_cell_id_expression	Cell ID from Annotation Tool	Tool Cell ID		adc_annotation_cell_id	string	FALSE	FALSE																adc_annotation_cell_id				IR_Expression	IR_ExpressionDB	adc_annotation_cell_id	adc_annotation_cell_id	FALSE	string															adc_annotation_cell_id				adc_annotation_cell_id	string	adc_annotation_cell_id			
ir_annotation_set_metadata_id_expression				ir_annotation_set_metadata_id_expression	string	FALSE	FALSE																				IR_Expression	IR_ExpressionDB			FALSE	string															ir_annotation_set_metadata_id_expression									
ir_created_at_expression	Creation Date	Creation Date		ir_created_at_expression	string	FALSE	FALSE																				IR_Expression	IR_ExpressionDB			FALSE	string															ir_created_at_expression									
ir_updated_at_expression	Update Date	Update Date		ir_updated_at_expression	string	FALSE	FALSE																				IR_Expression	IR_ExpressionDB			FALSE	string															ir_updated_at_expression									
ir_property_label_expression	Expression label	Expression label		ir_property_label_expression	string	FALSE	FALSE																				IR_Expression	IR_ExpressionDB			FALSE	string															ir_property_label_expression									
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
receptor_id_receptor	Receptor ID	Receptor ID		receptor_id	string	FALSE	FALSE																receptor_id		TRUE	TRUE	Receptor	Receptor	receptor_id	receptor_id	FALSE	string	"ID of the current Receptor object, globally unique."	Receptor ID	FALSE	TRUE	TRUE	TCR-MM-012345									receptor_id				receptor_id	string	receptor_id			
receptor_hash_receptor	Receptor Hash	Receptor Hash		receptor_hash	string	FALSE	FALSE																receptor_hash		TRUE	TRUE	Receptor	Receptor	receptor_hash	receptor_hash	FALSE	string	"The SHA256 hash of the receptor amino acid sequence, calculated on the concatenated ``receptor_variable_domain_*_aa`` sequences and represented as base16-encoded string."	Receptor hash ID	FALSE	TRUE		aa1c4b77a6f4927611ab39f5267415beaa0ba07a952c233d803b07e52261f026									receptor_hash				receptor_hash	string	receptor_hash			
receptor_type_receptor	Receptor Type	Receptor Type		receptor_type	string	FALSE	FALSE																receptor_type		TRUE	TRUE	Receptor	Receptor	receptor_type	receptor_type	FALSE	string	"The top-level receptor type, either Immunoglobulin (Ig) or T Cell Receptor (TCR)."		FALSE	TRUE						controlled_vocabulary				"Ig,TCR"	receptor_type				receptor_type	string	receptor_type			
receptor_variable_domain_1_aa_receptor	Receptor Variable Domain 1 AA	Receptor Variable Domain 1 AA		receptor_variable_domain_1_aa	string	FALSE	FALSE																receptor_variable_domain_1_aa		TRUE	TRUE	Receptor	Receptor	receptor_variable_domain_1_aa	receptor_variable_domain_1_aa	FALSE	string	"Complete amino acid sequence of the mature variable domain of the Ig heavy, TCR beta or TCR delta chain. The mature variable domain is defined as encompassing all AA from and including first AA after the the signal peptide to and including the last AA that is completely encoded by the J gene."		FALSE	TRUE		QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSS									receptor_variable_domain_1_aa				receptor_variable_domain_1_aa	string	receptor_variable_domain_1_aa			
receptor_variable_domain_1_locus_receptor	Receptor Variable Domain 1 Locus	Receptor Variable Domain 1 Locus		receptor_variable_domain_1_locus	string	FALSE	FALSE																receptor_variable_domain_1_locus		TRUE	TRUE	Receptor	Receptor	receptor_variable_domain_1_locus	receptor_variable_domain_1_locus	FALSE	string	Locus from which the variable domain in receptor_variable_domain_1_aa originates		FALSE	TRUE		IGH				controlled_vocabulary				"IGH,TRB,TRD"	receptor_variable_domain_1_locus				receptor_variable_domain_1_locus	string	receptor_variable_domain_1_locus			
receptor_variable_domain_2_aa_receptor	Receptor Variable Domain 2 AA	Receptor Variable Domain 2 AA		receptor_variable_domain_2_aa	string	FALSE	FALSE																receptor_variable_domain_2_aa		TRUE	TRUE	Receptor	Receptor	receptor_variable_domain_2_aa	receptor_variable_domain_2_aa	FALSE	string	"Complete amino acid sequence of the mature variable domain of the Ig light, TCR alpha or TCR gamma chain. The mature variable domain is defined as encompassing all AA from and including first AA after the the signal peptide to and including the last AA that is completely encoded by the J gene."		FALSE	TRUE		QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL									receptor_variable_domain_2_aa				receptor_variable_domain_2_aa	string	receptor_variable_domain_2_aa			
receptor_variable_domain_2_locus_receptor	Receptor Variable Domain 2 Locus	Receptor Variable Domain 2 Locus		receptor_variable_domain_2_locus	string	FALSE	FALSE																receptor_variable_domain_2_locus		TRUE	TRUE	Receptor	Receptor	receptor_variable_domain_2_locus	receptor_variable_domain_2_locus	FALSE	string	Locus from which the variable domain in receptor_variable_domain_2_aa originates		FALSE	TRUE		IGL				controlled_vocabulary				"IGI,IGK,IGL,TRA,TRG"	receptor_variable_domain_2_locus				receptor_variable_domain_2_locus	string	receptor_variable_domain_2_locus			
receptor_ref_receptor	Receptor Ref	Receptor Ref		receptor_ref	string	TRUE	FALSE																receptor_ref		TRUE	FALSE	Receptor	Receptor	receptor_ref	receptor_ref	TRUE	string	Array of receptor identifiers defined for the Receptor object	Receptor cross-references	TRUE	TRUE		['IEDB_RECEPTOR:10']									receptor_ref				receptor_ref	string	receptor_ref			
reactivity_measurements_receptor	Reactivity Measurements	Reactivity Measurements		reactivity_measurements	string	TRUE	FALSE																reactivity_measurements		TRUE	FALSE	Receptor	Receptor	reactivity_measurements	reactivity_measurements	TRUE	string	Array of reactivity measurement identifiers for this Receptor object	Reactivity measurements	TRUE			"['id1', 'id2']"									reactivity_measurements				reactivity_measurements	string	reactivity_measurements			
ir_annotation_set_metadata_id_receptor				ir_annotation_set_metadata_id_receptor	string	FALSE	FALSE																				IR_Receptor	IR_ReceptorDB			FALSE	string															ir_annotation_set_metadata_id_receptor									
ir_created_at_receptor	Creation Date	Creation Date		ir_created_at_receptor	string	FALSE	FALSE																				IR_Receptor	IR_ReceptorDB			FALSE	string															ir_created_at_receptor									
ir_updated_at_receptor	Update Date	Update Date		ir_updated_at_receptor	string	FALSE	FALSE																				IR_Receptor	IR_ReceptorDB			FALSE	string															ir_updated_at_receptor									
ir_receptor_id_receptor	User Receptor ID	User Receptor ID		adc_annotation_receptor_id	string	FALSE	FALSE																adc_annotation_receptor_id				IR_Receptor	IR_ReceptorDB	adc_annotation_receptor_id	adc_annotation_receptor_id	FALSE	string															adc_annotation_receptor_id				adc_annotation_receptor_id	string	adc_annotation_receptor_id			
																	Planned Process										AKC_Metadata	AKC_Planned Process																												
reactivity_id_reactivity	Reactivity ID	Reactivity ID		reactivity_id	string	FALSE	FALSE																reactivity_id		TRUE	TRUE	Reactivity	Reactivity	reactivity_id	reactivity_id	FALSE	string	"ID of this ReceptorReactivity object, globally unique."	Receptor Reactivity ID	FALSE	TRUE	TRUE										reactivity_id				reactivity_id	string	reactivity_id			
ligand_type_reactivity	Ligand Type	Ligand Type		ligand_type	string	FALSE	FALSE																ligand_type		TRUE	TRUE	Reactivity	Reactivity	ligand_type	ligand_type	FALSE	string	Classification of ligand binding to receptor		FALSE			non-peptide				controlled_vocabulary				"MHC:peptide,MHC:non-peptide,protein,peptide,non-peptidic"	ligand_type				ligand_type	string	ligand_type			
antigen_type_reactivity	Antigen Type	Antigen Type		antigen_type	string	FALSE	FALSE																antigen_type		TRUE	TRUE	Reactivity	Reactivity	antigen_type	antigen_type	FALSE	string	The type of antigen before processing by the immune system.		FALSE			protein				controlled_vocabulary				"protein,peptide,non-peptidic"	antigen_type				antigen_type	string	antigen_type			
antigen_reactivity	Antigen	Antigen		antigen	string	FALSE	FALSE																antigen		TRUE	TRUE	Reactivity	Reactivity	antigen.label	antigen.label	FALSE	string	"The substance against which the receptor was tested. This can be any substance that stimulates an adaptive immune response in the host, either through antibody production or by T cell activation after presentation via an MHC molecule."	Antigen	FALSE	TRUE		"UNIPROT:P19597, Circumsporozoite protein"				ontology					antigen				antigen	string	antigen			
antigen_id_reactivity	Antigen ID	Antigen ID		antigen_id	string	FALSE	FALSE																antigen_id		TRUE	TRUE	Reactivity	Reactivity	antigen.id	antigen.id	FALSE	string	"The substance against which the receptor was tested. This can be any substance that stimulates an adaptive immune response in the host, either through antibody production or by T cell activation after presentation via an MHC molecule. (Ontology ID)"	Antigen (Ontology ID)	FALSE	TRUE		"UNIPROT:P19597, Circumsporozoite protein"				ontology					antigen_id				antigen_id	string	antigen_id			
antigen_source_species_reactivity	Antigen Source Species	Antigen Source Species		antigen_source_species	string	FALSE	FALSE																antigen_source_species		TRUE	FALSE	Reactivity	Reactivity	antigen_source_species.label	antigen_source_species.label	FALSE	string	The species from which the antigen was isolated	Source species of antigen	TRUE			"NCBITAXON:5843, Plasmodium falciparum NF54"				ontology					antigen_source_species				antigen_source_species	string	antigen_source_species			
antigen_source_species_id_reactivity	Antigen Source Species ID	Antigen Source Species ID		antigen_source_species_id	string	FALSE	FALSE																antigen_source_species_id		TRUE	FALSE	Reactivity	Reactivity	antigen_source_species.id	antigen_source_species.id	FALSE	string	The species from which the antigen was isolated (Ontology ID)	Source species of antigen (Ontology ID)	TRUE			"NCBITAXON:5843, Plasmodium falciparum NF54"				ontology					antigen_source_species_id				antigen_source_species_id	string	antigen_source_species_id			
peptide_start_reactivity	Peptide Start	Peptide Start		peptide_start	integer	FALSE	FALSE																peptide_start		TRUE	FALSE	Reactivity	Reactivity	peptide_start	peptide_start	FALSE	integer	Start position of the peptide within the reference protein sequence		TRUE												peptide_start				peptide_start	integer	peptide_start			
peptide_end_reactivity	Peptide End	Peptide End		peptide_end	integer	FALSE	FALSE																peptide_end		TRUE	FALSE	Reactivity	Reactivity	peptide_end	peptide_end	FALSE	integer	End position of the peptide within the reference protein sequence		TRUE												peptide_end				peptide_end	integer	peptide_end			
peptide_sequence_aa_reactivity	Peptide Sequence AA	Peptide Sequence AA		peptide_sequence_aa	string	FALSE	FALSE																peptide_sequence_aa		TRUE	FALSE	Reactivity	Reactivity	peptide_sequence_aa	peptide_sequence_aa	FALSE	string	The actual peptide sequence against which the receptor reactivity was measured. This field should be used as a convenience for antigens of antigen_type `protein` or `peptide`.		TRUE	TRUE											peptide_sequence_aa				peptide_sequence_aa	string	peptide_sequence_aa			
mhc_class_reactivity	Mhc Class	Mhc Class		mhc_class	string	FALSE	FALSE																mhc_class		TRUE	FALSE	Reactivity	Reactivity	mhc_class	mhc_class	FALSE	string	"Class of MHC molecule, only present for MHC:x ligand types"		TRUE			MHC-II				controlled_vocabulary				"MHC-I,MHC-II,MHC-nonclassical,null"	mhc_class				mhc_class	string	mhc_class			
mhc_gene_1_reactivity	Mhc Gene 1	Mhc Gene 1		mhc_gene_1	string	FALSE	FALSE																mhc_gene_1		TRUE	FALSE	Reactivity	Reactivity	mhc_gene_1.label	mhc_gene_1.label	FALSE	string	The MHC gene to which the mhc_allele_1 belongs	MHC gene 1	TRUE			"MRO:0000055, HLA-DRA"				ontology					mhc_gene_1				mhc_gene_1	string	mhc_gene_1			
mhc_gene_1_id_reactivity	Mhc Gene 1 ID	Mhc Gene 1 ID		mhc_gene_1_id	string	FALSE	FALSE																mhc_gene_1_id		TRUE	FALSE	Reactivity	Reactivity	mhc_gene_1.id	mhc_gene_1.id	FALSE	string	The MHC gene to which the mhc_allele_1 belongs (Ontology ID)	MHC gene 1 (Ontology ID)	TRUE			"MRO:0000055, HLA-DRA"				ontology					mhc_gene_1_id				mhc_gene_1_id	string	mhc_gene_1_id			
mhc_allele_1_reactivity	Mhc Allele 1	Mhc Allele 1		mhc_allele_1	string	FALSE	FALSE																mhc_allele_1		TRUE	FALSE	Reactivity	Reactivity	mhc_allele_1	mhc_allele_1	FALSE	string	Allele designation of the MHC alpha chain		TRUE			HLA-DRA									mhc_allele_1				mhc_allele_1	string	mhc_allele_1			
mhc_gene_2_reactivity	Mhc Gene 2	Mhc Gene 2		mhc_gene_2	string	FALSE	FALSE																mhc_gene_2		TRUE	FALSE	Reactivity	Reactivity	mhc_gene_2.label	mhc_gene_2.label	FALSE	string	The MHC gene to which the mhc_allele_2 belongs	MHC gene 2	TRUE			"MRO:0000057, HLA-DRB1"				ontology					mhc_gene_2				mhc_gene_2	string	mhc_gene_2			
mhc_gene_2_id_reactivity	Mhc Gene 2 ID	Mhc Gene 2 ID		mhc_gene_2_id	string	FALSE	FALSE																mhc_gene_2_id		TRUE	FALSE	Reactivity	Reactivity	mhc_gene_2.id	mhc_gene_2.id	FALSE	string	The MHC gene to which the mhc_allele_2 belongs (Ontology ID)	MHC gene 2 (Ontology ID)	TRUE			"MRO:0000057, HLA-DRB1"				ontology					mhc_gene_2_id				mhc_gene_2_id	string	mhc_gene_2_id			
mhc_allele_2_reactivity	Mhc Allele 2	Mhc Allele 2		mhc_allele_2	string	FALSE	FALSE																mhc_allele_2		TRUE	FALSE	Reactivity	Reactivity	mhc_allele_2	mhc_allele_2	FALSE	string	Allele designation of the MHC class II beta chain or the invariant beta2-microglobin chain		TRUE			HLA-DRB1*04:01									mhc_allele_2				mhc_allele_2	string	mhc_allele_2			
reactivity_method_reactivity	Reactivity Method	Reactivity Method		reactivity_method	string	FALSE	FALSE																reactivity_method		TRUE	TRUE	Reactivity	Reactivity	reactivity_method	reactivity_method	FALSE	string	The methodology used to assess expression (assay implemented in experiment)		FALSE							controlled_vocabulary				"SPR,ITC,ELISA,cytometry,biological_activity,MHC_peptide_multimer"	reactivity_method				reactivity_method	string	reactivity_method			
reactivity_readout_reactivity	Reactivity Readout	Reactivity Readout		reactivity_readout	string	FALSE	FALSE																reactivity_readout		TRUE	TRUE	Reactivity	Reactivity	reactivity_readout	reactivity_readout	FALSE	string	Reactivity measurement read-out		FALSE			cytokine release				controlled_vocabulary				"binding_strength,cytokine_release,dissociation_constant_kd,on_rate,off_rate,pathogen_inhibition,barcode_count"	reactivity_readout				reactivity_readout	string	reactivity_readout			
reactivity_value_reactivity	Reactivity Value	Reactivity Value		reactivity_value	number	FALSE	FALSE																reactivity_value		TRUE	TRUE	Reactivity	Reactivity	reactivity_value	reactivity_value	FALSE	number	The absolute (processed) value of the measurement		FALSE			162.26									reactivity_value				reactivity_value	number	reactivity_value			
reactivity_unit_reactivity	Reactivity Unit	Reactivity Unit		reactivity_unit	string	FALSE	FALSE																reactivity_unit		TRUE	TRUE	Reactivity	Reactivity	reactivity_unit	reactivity_unit	FALSE	string	The unit of the measurement		FALSE			pg/ml									reactivity_unit				reactivity_unit	string	reactivity_unit			
reactivity_ref_reactivity	Reactivity Ref	Reactivity Ref		reactivity_ref	string	TRUE	FALSE																reactivity_ref		TRUE	TRUE	Reactivity	Reactivity	reactivity_ref	reactivity_ref	TRUE	string	List of external reactivity IDs		FALSE												reactivity_ref				reactivity_ref	string	reactivity_ref			
repertoire_id_reactivity	Parental Repertoire Of Reactivity	Parental Repertoire Of Reactivity		repertoire_id	string	FALSE	FALSE																repertoire_id	Parental repertoire of reactivity	TRUE	TRUE	Reactivity	Reactivity	repertoire_id	repertoire_id	FALSE	string	Identifier for the associated repertoire in study metadata.	Parental repertoire of reactivity	TRUE	TRUE			TRUE								repertoire_id				repertoire_id	string	repertoire_id			
sample_processing_id_reactivity	Sample Processing For Reactivity	Sample Processing For Reactivity		sample_processing_id	string	FALSE	FALSE																sample_processing_id	Sample processing for reactivity	TRUE	TRUE	Reactivity	Reactivity	sample_processing_id	sample_processing_id	FALSE	string	Identifier of the sample processing object in the repertoire metadata for this clone.	Sample processing for reactivity	TRUE	TRUE			TRUE								sample_processing_id				sample_processing_id	string	sample_processing_id			
data_processing_id_reactivity	Data Processing For Reactivity	Data Processing For Reactivity		data_processing_id	string	FALSE	FALSE																data_processing_id	Data processing for reactivity	TRUE	TRUE	Reactivity	Reactivity	data_processing_id	data_processing_id	FALSE	string	Identifier of the data processing object in the repertoire metadata for this clone.	Data processing for reactivity	TRUE	TRUE			TRUE								data_processing_id				data_processing_id	string	data_processing_id			
ir_annotation_set_metadata_id_reactivity				ir_annotation_set_metadata_id_reactivity	string	FALSE	FALSE																				IR_Reactivity	IR_ReactivityDB			FALSE	string															ir_annotation_set_metadata_id_reactivity									
ir_created_at_reactivity	Creation Date	Creation Date		ir_created_at_reactivity	string	FALSE	FALSE																				IR_Reactivity	IR_ReactivityDB			FALSE	string															ir_created_at_reactivity									
ir_updated_at_reactivity	Update Date	Update Date		ir_updated_at_reactivity	string	FALSE	FALSE																				IR_Reactivity	IR_ReactivityDB			FALSE	string															ir_updated_at_reactivity									
ir_reactivity_id_reactivity	User ReceptorReactivity ID	User Receptor Reactivity ID		adc_annotation_reactivity_id	string	FALSE	FALSE																adc_annotation_reactivity_id				IR_Reactivity	IR_ReactivityDB	adc_annotation_reactivity_id	adc_annotation_reactivity_id	FALSE	string															adc_annotation_reactivity_id				adc_annotation_reactivity_id	string	adc_annotation_reactivity_id			
ir_receptor_id_reactivity	Receptor reactivity is associated with	Receptor ID		ir_receptor_id_reactivity	string	FALSE	FALSE																				IR_Reactivity	IR_ReactivityDB	ir_receptor_id_reactivity	ir_receptor_id_reactivity	FALSE	string															ir_receptor_id_reactivity				ir_receptor_id_reactivity	string	ir_receptor_id_reactivity			
ir_cell_id_reactivity	Cell ID from Annotation Tool	Tool Cell ID		adc_annotation_cell_id	string	FALSE	FALSE																adc_annotation_cell_id				IR_Reactivity	IR_ReactivityDB	adc_annotation_cell_id	adc_annotation_cell_id	FALSE	string															adc_annotation_cell_id				adc_annotation_cell_id	string	adc_annotation_cell_id			
cell_id_reactivity	Cell ID	Cell ID		cell_id	string	FALSE	FALSE																cell_id		TRUE	TRUE	Reactivity	Reactivity	cell_id	cell_id	FALSE	string	ID of the Cell ID	Cell ID	FALSE	TRUE	TRUE										cell_id				cell_id	string	cell_id