Initial commit

.github/workflows/deploy.yml

@@ -0,0 +1,48 @@
+name: Build and Deploy
+
+on:
+  push:
+    branches:
+      - main
+  pull_request:
+    branches:
+      - '*'
+
+jobs:
+  build:
+    runs-on: ubuntu-latest
+    steps:
+      - name: Checkout
+        uses: actions/checkout@v4
+      - name: Setup Python
+        uses: actions/setup-python@v5
+        with:
+          python-version: '3.11'
+      - name: Install the dependencies
+        run: |
+          python -m pip install -r requirements.txt
+      - name: Build the JupyterLite site
+        run: |
+          cp README.md content
+          jupyter lite build --contents content --output-dir dist
+      - name: Upload artifact
+        uses: actions/upload-pages-artifact@v3
+        with:
+          path: ./dist
+
+  deploy:
+    needs: build
+    if: github.ref == 'refs/heads/main'
+    permissions:
+      pages: write
+      id-token: write
+
+    environment:
+      name: github-pages
+      url: ${{ steps.deployment.outputs.page_url }}
+
+    runs-on: ubuntu-latest
+    steps:
+      - name: Deploy to GitHub Pages
+        id: deployment
+        uses: actions/deploy-pages@v4

.gitignore

@@ -0,0 +1,116 @@
+*.bundle.*
+lib/
+node_modules/
+.yarn-packages/
+*.egg-info/
+.ipynb_checkpoints
+*.tsbuildinfo
+
+# Created by https://www.gitignore.io/api/python
+# Edit at https://www.gitignore.io/?templates=python
+
+### Python ###
+# Byte-compiled / optimized / DLL files
+__pycache__/
+*.py[cod]
+*$py.class
+
+# C extensions
+*.so
+
+# Distribution / packaging
+.Python
+build/
+develop-eggs/
+dist/
+downloads/
+eggs/
+.eggs/
+lib/
+lib64/
+parts/
+sdist/
+var/
+wheels/
+pip-wheel-metadata/
+share/python-wheels/
+.installed.cfg
+*.egg
+MANIFEST
+
+# PyInstaller
+#  Usually these files are written by a python script from a template
+#  before PyInstaller builds the exe, so as to inject date/other infos into it.
+*.manifest
+*.spec
+
+# Installer logs
+pip-log.txt
+pip-delete-this-directory.txt
+
+# Unit test / coverage reports
+htmlcov/
+.tox/
+.nox/
+.coverage
+.coverage.*
+.cache
+nosetests.xml
+coverage.xml
+*.cover
+.hypothesis/
+.pytest_cache/
+
+# Translations
+*.mo
+*.pot
+
+# Scrapy stuff:
+.scrapy
+
+# Sphinx documentation
+docs/_build/
+
+# PyBuilder
+target/
+
+# pyenv
+.python-version
+
+# celery beat schedule file
+celerybeat-schedule
+
+# SageMath parsed files
+*.sage.py
+
+# Spyder project settings
+.spyderproject
+.spyproject
+
+# Rope project settings
+.ropeproject
+
+# Mr Developer
+.mr.developer.cfg
+.project
+.pydevproject
+
+# mkdocs documentation
+/site
+
+# mypy
+.mypy_cache/
+.dmypy.json
+dmypy.json
+
+# Pyre type checker
+.pyre/
+
+# OS X stuff
+*.DS_Store
+
+# End of https://www.gitignore.io/api/python
+
+# jupyterlite
+*.doit.db
+_output

.nojekyll

@@ -0,0 +1 @@
+

README.md

@@ -0,0 +1,29 @@
+# JupyterLite Demo
+
+[![lite-badge](https://jupyterlite.rtfd.io/en/latest/_static/badge.svg)](https://jupyterlite.github.io/demo)
+
+JupyterLite deployed as a static site to GitHub Pages, for demo purposes.
+
+## ✨ Try it in your browser ✨
+
+➡️ **https://jupyterlite.github.io/demo**
+
+![github-pages](https://user-images.githubusercontent.com/591645/120649478-18258400-c47d-11eb-80e5-185e52ff2702.gif)
+
+## Requirements
+
+JupyterLite is being tested against modern web browsers:
+
+- Firefox 90+
+- Chromium 89+
+
+## Deploy your JupyterLite website on GitHub Pages
+
+Check out the guide on the JupyterLite documentation: https://jupyterlite.readthedocs.io/en/latest/quickstart/deploy.html
+
+## Further Information and Updates
+
+For more info, keep an eye on the JupyterLite documentation:
+
+- How-to Guides: https://jupyterlite.readthedocs.io/en/latest/howto/index.html
+- Reference: https://jupyterlite.readthedocs.io/en/latest/reference/index.html

content/data/bar.vl.json

@@ -0,0 +1,54 @@
+{
+  "data": {
+    "values": [
+      {
+        "a": "A",
+        "b": 28
+      },
+      {
+        "a": "B",
+        "b": 55
+      },
+      {
+        "a": "C",
+        "b": 43
+      },
+      {
+        "a": "D",
+        "b": 91
+      },
+      {
+        "a": "E",
+        "b": 81
+      },
+      {
+        "a": "F",
+        "b": 53
+      },
+      {
+        "a": "G",
+        "b": 19
+      },
+      {
+        "a": "H",
+        "b": 87
+      },
+      {
+        "a": "I",
+        "b": 52
+      }
+    ]
+  },
+  "description": "A simple bar chart with embedded data.",
+  "encoding": {
+    "x": {
+      "field": "a",
+      "type": "ordinal"
+    },
+    "y": {
+      "field": "b",
+      "type": "quantitative"
+    }
+  },
+  "mark": "bar"
+}

content/data/fasta-example.fasta

@@ -0,0 +1,8 @@
+>SEQUENCE_1
+MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
+LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
+IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL
+MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL
+>SEQUENCE_2
+SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI
+ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH